DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and LOC101883528

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 ID: Length:261 Species:Danio rerio

Alignment Length:208 Identity:49/209 (23%)
Similarity:78/209 (37%) Gaps:55/209 (26%)


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            ||:.||:.|:.:...       |..|..:||||.:..:|......|..:|:.   ......:|:|
Zfish    31 IVDLHNELRSQVQPS-------AAFMQKVVWDETIRLVAEGYAAKCIWDHNP---DLEHLTMGEN 85

  Fly   132 L-CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVG 195
            | .|..     ..|.|..|..    ||.|:  :|.:|.|: ...:| :..||:.:.|....|.:|
Zfish    86 LFVGTG-----PFNATKAVMD----WFNEN--LDYNYNTN-DCAED-KMCGHYTQLVWANTTKIG 137

  Fly   196 CAMMRFTNPQYPFLYIYNT------------ACNYASVYAI-GVPVYNAGKPASECRTGSNPE-- 245
            ||.           |..:|            .|:|.....| |...|.:|:..|:|     ||  
Zfish   138 CAS-----------YFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKC-----PEEC 186

  Fly   246 YPALCSIKEQYNP 258
            ...:|.::..:.|
Zfish   187 ENNICVMENLFPP 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 39/165 (24%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5169
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.