DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and pi16

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017946207.1 Gene:pi16 ID: Length:487 Species:Xenopus tropicalis

Alignment Length:202 Identity:42/203 (21%)
Similarity:82/203 (40%) Gaps:41/203 (20%)


  Fly    64 RKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNL 128
            :::|:::|    |:..|.:.|.   |:.|..:.||..||.:|....:.|..||:.....     :
 Frog    30 KRIILDKH----NFYRSQTEPS---ASDMIKLTWDSALEAMAKSYAEKCIWEHNKDRGF-----I 82

  Fly   129 GQNLCGVDRRRNWDLNVTNLVEQSMGL--WFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRN 191
            |:||        :.::.::| :.::||  |..|.    ..|.....:.::.:..||:.:.|....
 Frog    83 GENL--------FVMSGSSL-DVALGLDDWHKER----GYYNFTTGMCQEGQMCGHYTQMVWAGT 134

  Fly   192 THVGCAM-----MRFTNPQYPFLYIYNTACNYASVYAI-GVPVYNAGKPASECRTGSNPEYPALC 250
            ..|||..     :...:.:..:|.:    |||...... |...|..|...:||.:    ::..:.
 Frog   135 ERVGCGQNFCPKLEGVDDENMYLLV----CNYEPPGNFEGESPYKEGSRCTECPS----DHVCIG 191

  Fly   251 SIKEQYN 257
            |:.|..|
 Frog   192 SLCENMN 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 34/162 (21%)
pi16XP_017946207.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.