DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and pi15

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis

Alignment Length:198 Identity:56/199 (28%)
Similarity:74/199 (37%) Gaps:39/199 (20%)


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            ||..||:.|..:       :.||..|..|||||.|..||.....||..:|..   ||..:.||||
 Frog    70 IVEYHNQVRGKV-------FPPAANMEYMVWDENLAKLAEAWAATCIWDHGP---SYLLKFLGQN 124

  Fly   132 LCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG----HFVETVLDRNT 192
            |   ..|.....::..||:.    |:.|.|.....|..:......|..||    |:.:.|.....
 Frog   125 L---SVRTGRYKSILQLVKP----WYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTN 182

  Fly   193 HVGCAMMRFTNPQYPFLYIYNT--------ACNYA-SVYAIGVPVYNAGKPASECRTGSNPEYPA 248
            .:|||:....|     :.::..        .|||: ....||...|..|.|.|.|    .|.|..
 Frog   183 RIGCAIHTCHN-----MNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSAC----PPSYGG 238

  Fly   249 LCS 251
            .||
 Frog   239 SCS 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 45/164 (27%)
pi15XP_002937120.1 SCP_euk 69..212 CDD:240180 45/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5039
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.