DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30394 and VGAT

Sequence 1:NP_611578.1 Gene:CG30394 FlyBaseID:FBgn0050394 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_610938.1 Gene:VGAT FlyBaseID:FBgn0033911 Length:549 Species:Drosophila melanogaster

Alignment Length:453 Identity:103/454 (23%)
Similarity:182/454 (40%) Gaps:105/454 (23%)


  Fly    11 LANSIIGVGILAMPFCFQKCGILLSIVLLVLSNGITRVCCH---YLIK--------TSLLTR-RR 63
            :.|:|.|:.|:::||.....| ..:||.:|   ||..:||:   .|::        |..:.| |.
  Fly   150 VTNAIQGMFIVSLPFAVLHGG-YWAIVAMV---GIAHICCYTGKVLVQCLYEPDPATGQMVRVRD 210

  Fly    64 SFEMLGLHAFGTS-GKLLVELCIIGYLIGTCITYFVVVGDLGPQIIAKIFALDVADHLHLRSLVM 127
            |:..:....||.. |...|.:..:..|:.|||.|.||.|||    :|..:.....|.   ||.::
  Fly   211 SYVAIAKVCFGPKLGARAVSIAQLIELLMTCILYVVVCGDL----LAGTYPQGSFDS---RSWML 268

  Fly   128 VVVTVVCIVPLGMLRN---VDSLSAVCTASIGFYVCLILKIVLEAQPHITANDWTEKVLYWEPAG 189
            .|  .:.::|:|.|::   |.:||..||.|     .:::..|:.....:...||.     |.   
  Fly   269 FV--GIFLLPMGFLKSLKMVSTLSFWCTMS-----HIVINAVILGYCLLQIGDWG-----WS--- 318

  Fly   190 VLQCLPIFSMALSCQMQLFE------VFESINNQSLDKLNG--IVRNA-TWICTFVYISVGF--- 242
                    .:..|..|:.|.      ||...:...|..|.|  |.|:. .|:..:.:|:...   
  Fly   319 --------KVRFSIDMENFPISLGVIVFSYTSQIFLPTLEGNMIDRSKFNWMLDWSHIAAAVFKA 375

  Fly   243 -FGYVAFCTHTFSGN----ILVNLSTSFGSDIIKIGFVLSIAFSFPLVIFPCRASLYSLLYRKGH 302
             |||:.|.  ||..:    |..||.:.....::....|:....|:||   |..|:...|      
  Fly   376 GFGYICFL--TFQNDTQQVITNNLHSQGFKGMVNFFLVIKALLSYPL---PYYAACELL------ 429

  Fly   303 TESSSYIPEQRFRFITIF----------------IVVFSLCVALVIPSVELIIGLVGSTIGVAIC 351
             |.:.:....:.:|.||:                ::|.::.:|:.||...:::|.:||..|..:.
  Fly   430 -ERNFFRGPPKTKFPTIWNLDGELKVWGLGFRVGVIVSTILMAIFIPHFSILMGFIGSFTGTMLS 493

  Fly   352 IMFPASSFRKIIKKESMERTLAQ--FVFVSGFLLMILGTYANLSAIDEKSSGPEFDMVAIGTP 412
            .::|.....||......::.:|:  .:...|.|..::|.|.:.:|:        .:...||.|
  Fly   494 FIWPCYFHIKIKGHLLDQKEIAKDYLIIGLGVLFGVIGIYDSGNAL
--------INAFEIGLP 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30394NP_611578.1 SdaC 8..392 CDD:223884 99/432 (23%)
SLC5-6-like_sbd 8..390 CDD:294310 99/430 (23%)
DUF4775 <394..652 CDD:292620 4/20 (20%)
YukC <561..660 CDD:295067
VGATNP_610938.1 SLC5-6-like_sbd 144..533 CDD:294310 98/429 (23%)
SdaC 159..539 CDD:223884 97/426 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97895001
eggNOG 1 0.900 E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22950
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.