DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and NRD1

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_014148.1 Gene:NRD1 SGDID:S000005195 Length:575 Species:Saccharomyces cerevisiae

Alignment Length:816 Identity:148/817 (18%)
Similarity:248/817 (30%) Gaps:289/817 (35%)


  Fly    11 LSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYVIDSIVR---- 71
            |....|.:..||.:::..:|..|:..|.:...::..:..:...|...:|:..||:||||.|    
Yeast    14 LESFKDLKSGISGSRIKKLTTYALDHIDIESKIISLIIDYSRLCPDSHKLGSLYIIDSIGRAYLD 78

  Fly    72 --QSRHQYGMDKDLFAPRFQRNLTETFANLFRCA-----PEDKSRIIRVLNLWQKNNVFKSEVIQ 129
              :|......:|..........|.|....|...|     .:.|.:|..:|::|.::.:|:...:.
Yeast    79 ETRSNSNSSSNKPGTCAHAINTLGEVIQELLSDAIAKSNQDHKEKIRMLLDIWDRSGLFQKSYLN 143

  Fly   130 PIFDLADPNHPIYHQMPPVGGSGGQGGGVGPGPSSSGALSLADISSGPNGLNSSGMEISMNSSGG 194
            .|                                .|...:: |||:  |..|::..::|:     
Yeast   144 AI--------------------------------RSKCFAM-DISN--NTANTASQQLSL----- 168

  Fly   195 DDKMGGAMPDLSLGHEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDID 259
            |.|                               .:.:.::|...|                   
Yeast   169 DPK-------------------------------QRSKQILSNLKK------------------- 183

  Fly   260 YQVREIIEEEDEGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPNVLRQLHTLQNFQNLK 324
                                        |||.:.|:    .:...|.:.:..:|...|  ||.: 
Yeast   184 ----------------------------SPPLNLNI----SLPTDLTSTDPAKQQAAL--FQVI- 213

  Fly   325 PQEENQKHRYQDEALQQHFQNVMKGNAGMPPGMGMGMNMNDSMDLNKDVEFISEQQTIEVINLDG 389
                        .|||:||:.       :|....:|.              ::..|...:  .:.
Yeast   214 ------------AALQKHFKT-------LPSHTSVGT--------------VAPPQAHTI--TEY 243

  Fly   390 GDSRSPTPDRDRYKRSRRNSRSRTRSPRGRGAGGGTG-NDRRRRGTRSRSRSRSPRSSRRRGSRD 453
            |..|....:|:|| .||||   |:|||....:...|| .||.....:.:....:|.::  .|:.:
Yeast   244 GSRRERERERERY-NSRRN---RSRSPPAPFSQPSTGRKDRYPSVAQDQYSIGAPNTT--FGTNN 302

  Fly   454 R----DRMDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGE 514
            .    |.::.||      ..|.|.:.......:..:|:.|.|.||::|.:...:.:.:|::....
Yeast   303 HHLYPDELNVSN------NPHYRPKPVSYDSTLPPDHIKVYSRTLFIGGVPLNMKEWDLANVLKP 361

  Fly   515 YGDIVSIDQIVPRGCAFIVMNRRQDAHKAMQALKNHKLQGR-AITISWAAGKGVKSKEWKDYWDL 578
            :.::.|:.....|..||:.:..|   |:|...|:|....|. .:...|..|.|.     :|..|.
Yeast   362 FAEVQSVILNNSRKHAFVKVYSR---HEAENVLQNFNKDGALPLRTRWGVGFGP-----RDCCDY 418

  Fly   579 ELGVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQMKQKINQAKNAAKEHKGASIAEAAGAPSV- 642
            :.|.:.||..:|   ||.|                           .|....|.....:|.|.| 
Yeast   419 QHGYSIIPMHRL---TDAD---------------------------KKWSVSAQWGGTSGQPLVT 453

  Fly   643 GV--PPPNLIFG-------IDTTQPPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINM 698
            |:  ..|::|.|       |....|...|..||....|........:..:..|..|:|.|     
Yeast   454 GIVFEEPDIIVGEGVSSKAISQKMPTDSGRNGPRSGKPNKSGSISSISPVPYGNAPLASP----- 513

  Fly   699 PPPIMMPPTNMPPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMALPPGAPFPP--PGAVPP 761
                  ||.....|||.                           .|....|..|.|.  |.|..|
Yeast   514 ------PPQQYVQPMMQ---------------------------QPYGYAPNQPLPSQGPAAAAP 545

  Fly   762 PIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPPQQQ 797
            |:|            ..|.|....|.....:..|||
Yeast   546 PVP------------QQQFDPTAQLNSLMNMLNQQQ 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 27/125 (22%)
RRM <488..>593 CDD:223796 25/106 (24%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 17/77 (22%)
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
NRD1NP_014148.1 RPR 9..150 CDD:214731 29/168 (17%)
RRM_NRD1_SEB1_like 336..412 CDD:240777 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.