DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and rbm15

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_001335820.1 Gene:rbm15 ZFINID:ZDB-GENE-041008-192 Length:853 Species:Danio rerio

Alignment Length:984 Identity:180/985 (18%)
Similarity:269/985 (27%) Gaps:423/985 (43%)


  Fly   390 GDSRSPTPDRDRYKRSRRNSRSRTRS---PRGR------GAGGGTGNDRRRRGTRSRSRSRSPRS 445
            |..|||..     ||||.....|.|.   |..:      .:|||:.|        ..|.|:|...
Zfish     3 GKERSPVK-----KRSRALDDIRDRGGSHPTSKKMGVISNSGGGSNN--------GNSSSKSDGG 54

  Fly   446 SRRRG----SRDRDRMD-------------------------RSNRDKERDREHERERRKKGLPD 481
            |.|||    .||....|                         .|:...|..|.:.|...:..||.
Zfish    55 SARRGLLGDKRDGREFDGHVSSRTGNNHGYTSPVASSSGKNHASSLSLEAARTNSRGEARAPLPT 119

  Fly   482 IKKEHLSVCSTTLWVGHLSKLVYQEELSD----TFGEYGDI-VSIDQIVPRGCAFIVMNRRQDAH 541
            .:.|:     .||.:..|...:..||:.|    .|.::||: |.|.::.....||:...|..||.
Zfish   120 NESEY-----KTLKISELGSQLSDEEIEDGLFHEFKKFGDVSVKISRVNDERIAFVNFRRPDDAR 179

  Fly   542 KAMQALKNHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLSSDTDFDALEEGGMFD 606
            .|..|      :||.:                                              ::|
Zfish   180 AAKHA------RGRLV----------------------------------------------LYD 192

  Fly   607 EDTMPIQMKQKINQAKNAAKEHKGASIAEAAGAPSVGVPPPNLIFGIDTTQPPPVGPVGPVGPPP 671
            .   |::::......:.:....|....:..||...:            .||.|.        .|.
Zfish   193 R---PLKIEAVYLNRRRSRSPVKEDHFSVVAGHRHL------------HTQRPL--------SPT 234

  Fly   672 GPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPMMMPPTMMPPGFP 736
            |.|.....|..:..|:.|         |||        |||:         |..:........:.
Zfish   235 GLGYRDYRLQQLALGRLP---------PPP--------PPPL---------PRELEREREFAFYE 273

  Fly   737 GIGGPPHPMALPPGAPFPPPGAVPPPIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPPQQQANFN 801
            ....|.:  .....|||.....:.|              .||                 |:||..
Zfish   274 ARARPAY--IAERAAPFREEDFISP--------------EDD-----------------QRANRT 305

  Fly   802 PSPSNVDLSPAAMANEM---FQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAENGG-- 861
            ....|:|::  ...|::   |::.....:.|.:..:||..::....:.:.::.|.|.:....|  
Zfish   306 LFLGNLDIT--VTENDLRRAFERFGTITEVDIKRPTRGQSSTYGFLKFENLDMAHRAKISMSGKV 368

  Fly   862 ----------GGGGPGS-----GLGP----NAAFNEARARLNLNPIEH----------------- 890
                      |...|.:     ||||    .|...|......:..|::                 
Zfish   369 VGRNPIKIGYGKATPTTRLWVGGLGPWVPLTALAREFDRFGTIRTIDYRKGDTWAYIQYESLDAA 433

  Fly   891 --------GMP--------RPDFMDFDNRGGPGGPRGMGPRGNHNGGGPGGDFFPPNMNHNRFNQ 939
                    |.|        |.||.|.::|                             ...:|.|
Zfish   434 QAACTHMRGFPLGGPDRRLRVDFADTEHR-----------------------------YQQQFLQ 469

  Fly   940 PTSL--------------------MQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGA 984
            |..|                    ::.|.|||..|.:|             .::           
Zfish   470 PLPLQHYEIMAESFVHRATPEAIRVRERTPPPLHFRER-------------ELY----------- 510

  Fly   985 GPSGGGPGGAGTGGGGPGGRQ--QGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGG------ 1041
                     ||.....|..|:  :.|.|    .|....:|.|..::....|.:.|....      
Zfish   511 ---------AGAEWPAPTIRERVRTPAF----EPLEHLERERRREAWSLERELPGREAARKRRLM 562

  Fly  1042 --------GPGGRGRWSDDEDEGGNNFKRRGGP---GGPGGNRFRGERGGEMMDDRRGNNSRGGR 1095
                    .|.....|:         .:||..|   |.|||                  :||.||
Zfish   563 EDGRHLECSPDSSSEWA---------ARRRRPPSLEGSPGG------------------SSRDGR 600

  Fly  1096 GGPREDRERPGFGNR----RGSRDDSNR-------HSISSTDEGNKAASETEPKPKNVETELGST 1149
               ..|.|||...:|    |.||...:|       .|.|:..|.:..||..|.|.|..::..|  
Zfish   601 ---FSDSERPARADRVSPARESRSSLDRVPGEKRIKSNSNLSESSIGASPAERKRKAGDSAKG-- 660

  Fly  1150 NTGAPAAATRVDTEEDWDQELQDYEARMEAQKPGERASQSANSPPQEKLPAENENFAKPAD---V 1211
                   |::.|..|...:..|     ...|..|.:.|.:.|.    .|..:|.||  ||.   :
Zfish   661 -------ASKRDRSESSSKSNQ-----ASKQDAGGKLSMAWNG----MLLLKNSNF--PASMHLL 707

  Fly  1212 TGDPLVAKS 1220
            .||..||.|
Zfish   708 EGDLSVATS 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796 20/110 (18%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 20/81 (25%)
DUF2413 1147..>1254 CDD:287302 20/78 (26%)
Herpes_DNAp_acc <1206..1304 CDD:282746 7/19 (37%)
rbm15XP_001335820.1 RRM1_RBM15 124..201 CDD:240997 22/137 (16%)
RRM2_RBM15 297..383 CDD:240999 16/105 (15%)
RRM3_RBM15 386..458 CDD:241001 12/72 (17%)
Herpes_ICP4_C 495..>685 CDD:332854 54/271 (20%)
SPOC 684..850 CDD:311609 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.