DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and RBM15

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_073605.4 Gene:RBM15 HGNCID:14959 Length:977 Species:Homo sapiens

Alignment Length:823 Identity:174/824 (21%)
Similarity:255/824 (31%) Gaps:283/824 (34%)


  Fly   148 VGGSGGQGGGVGPGPSSSGALSLADISSGPNGLNSSGMEISMNSSGGDDKMGGAMPDLSL----- 207
            :|||||..|                                 :|||..|..||:...|.|     
Human    74 LGGSGGSNG---------------------------------SSSGKTDSGGGSRRSLHLDKSSS 105

  Fly   208 --GHEKF--GGGSSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEE 268
              |..::  |||||||:.|          |..|.|:|.|......|...:....         |.
Human   106 RGGSREYDTGGGSSSSRLH----------SYSSPSTKNSSGGGESRSSSRGGGG---------ES 151

  Fly   269 EDEGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEENQKHR 333
            ...|            ...|.|...:..:.|.:|        :.:|.:                :
Human   152 RSSG------------AASSAPGGGDGAEYKTLK--------ISELGS----------------Q 180

  Fly   334 YQDEALQQHFQNVMK--GNAGMP----PGMGMGMNMNDSMDLNKDVEFISEQQTIEVINLDGGDS 392
            ..|||::....:..|  |:..:.    .|.|.|         ::.|.|::.::.        .|:
Human   181 LSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSG---------DERVAFVNFRRP--------EDA 228

  Fly   393 RSPTPDRDR---YKR---------SRRNSRS----RTRSPRGRGAGGGTGNDRRRRGTRSRSRSR 441
            |:....|.|   |.|         |||.|||    .|..|.....|...|..|...|.....||.
Human   229 RAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSL 293

  Fly   442 SPRSSRRRGSRDRDRMDR-------------SNRDKERDRE---HERERRKKGL----------- 479
            || .....|.||. |:.:             ..||.||:|:   :||.|....|           
Human   294 SP-GGAALGYRDY-RLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAA 356

  Fly   480 -----PDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIVSIDQIVP-RG----CAFIVM 534
                 .:|..|.....:.||::|:|...|.:.:|...|..:|.|..:|...| ||    ..|:..
Human   357 PFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKF 421

  Fly   535 NRRQDAHKAMQALKNHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLSS-DTDFDA 598
            .....:|:|..|:....:....|.|.:  ||...:..   .|...||    ||..|:: ..:||.
Human   422 ENLDMSHRAKLAMSGKIIIRNPIKIGY--GKATPTTR---LWVGGLG----PWVPLAALAREFDR 477

  Fly   599 LEEGGMFDEDTMPIQMKQKINQAKN---AAKEHKGASIAEAAGAPSVGVP--PPNLIFGIDTT-- 656
            .        .|:     :.|:..|.   |..:::....|.||.....|.|  .|:....:|..  
Human   478 F--------GTI-----RTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADT 529

  Fly   657 ---------QPPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPP 712
                     ||.|:.....|....|..||.|     :||.....||:........:.|.::..||
Human   530 EHRYQQQYLQPLPLTHYELVTDAFGHRAPDP-----LRGARDRTPPLLYRDRDRDLYPDSDWVPP 589

  Fly   713 MMMPTTNMPPPM-----MMPPTMMPPGFP-----------GIGGPPHPMALPPGAPFPPPGAVPP 761
                    |||:     ....|.:|...|           .:........||.....|....:|.
Human   590 --------PPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPE 646

  Fly   762 PIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPPQQQANFNPSPSNVDLSPAAMANEMFQQRDR-- 824
              .|||:                .|:.:|.....::.:..|||   |.||     |:...|||  
Human   647 --ESGGR----------------HLDRSPESDRPRKRHCAPSP---DRSP-----ELSSSRDRYN 685

  Fly   825 -ERDRDN----------RDRSRGPGNSRWGGRDDVVEAAERWR 856
             :.||.:          ||| ||......|.:.|...:|...|
Human   686 SDNDRSSRLLLERPSPIRDR-RGSLEKSQGDKRDRKNSASAER 727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796 27/111 (24%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 21/81 (26%)
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
RBM15NP_073605.4 RRM1_RBM15 169..251 CDD:240997 19/123 (15%)
RRM2_RBM15 367..453 CDD:240999 22/88 (25%)
RRM3_RBM15 456..528 CDD:241001 19/92 (21%)
RRM 624..>736 CDD:330708 30/132 (23%)
SPOC 781..954 CDD:311609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.