DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and scaf4

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_012813473.1 Gene:scaf4 XenbaseID:XB-GENE-920206 Length:1340 Species:Xenopus tropicalis

Alignment Length:1500 Identity:457/1500 (30%)
Similarity:615/1500 (41%) Gaps:402/1500 (27%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            |:.|.|||.||..|.|.:||||:|||..|||:|::||||||||||.|||||.|||||||||||||
 Frog     1 MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|:|||:|.|||.:|||.||..|:.|..||||:|:|||||||||.|||.|:|||
 Frog    66 IDSIVRQSRHQFGIDKDVFGPRFTKNLTATFQCLYTCPSEDKSKIVRVLNLWQKNGVFKIEIIQP 130

  Fly   131 IFDLADPNHPIYHQMPPVGGSGGQGGGV---------GPGPSSSGALS-----------LADISS 175
            :.|:|               :|.....|         |..|.|...||           :|.:..
 Frog   131 LLDMA---------------AGAAAADVMTDSSMMEEGSSPPSGMILSEPPDEVQEPPPVAPVPQ 180

  Fly   176 GPNGLNSSGMEISMNSSGGDDKMGGAMPDLSLGHEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSK 240
            .|.....:.:.....|:.|.        .|....:.|............|..:::.|::.|..:.
 Frog   181 LPTPDAFAAVAQLFQSTQGQ--------QLQQILQTFQQPPKPQSPAIDENVFAQVQAITSQLNA 237

  Fly   241 TSKSHHHKREYVKSSHDIDYQVREIIEEEDEGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLL 305
            .:.....|..:.|.....||.     :|.|       |.:.......|||.|.:...:..::...
 Frog   238 PAHQPERKTAFDKLLDRFDYD-----DEPD-------ATEESKKEASSPPLSGSQQSQPPLQPFA 290

  Fly   306 NNPNVLR----------QLHTLQNFQNL---KPQEENQKHRYQDEALQQHFQNVMKGN------- 350
            .:.:.::          |:..:..||.:   .||          |.|.|..|....|.       
 Frog   291 FSADSMQPAAYPGQLPGQVPNMDQFQPMMMGMPQ----------EPLPQQTQLPPNGQMLGFGMV 345

  Fly   351 -----AGMPPGMG-----------MGMNMNDSMDLNKDVEFISEQQTIEVINLDGGDSRSPTPDR 399
                 |.|.|.||           ..|..|: |.:.|:     .||.:.:      |...|....
 Frog   346 PTQSFAPMVPPMGSEPSTHGFQNTFQMQPNE-MHVQKE-----HQQEMPM------DVEQPNVQE 398

  Fly   400 DRYKRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGSRDRDRMDRSNRDK 464
            :: :.....|:|.:|||:.|         |.|.|:||| |||..||..|  ||||.|....:|.:
 Frog   399 NK-RHMNEQSKSVSRSPKRR---------RSRSGSRSR-RSRHRRSRSR--SRDRRRHSPKSRSQ 450

  Fly   465 E-RDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIVSIDQIVPRG 528
            | ||||.|:|||:||||.||.|.:|:||||||:|.|.|...|:::.....|:|.|.||:.|.|||
 Frog   451 ERRDREKEKERRQKGLPPIKSETVSICSTTLWIGQLDKKTTQQDVGSFLEEFGPIESINMIPPRG 515

  Fly   529 CAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLS 591
            ||:|||..||||::|:..|.  |.|:..:||.|:||..||:|: |:|.|||:|:|||||||:|:.
 Frog   516 CAYIVMVHRQDAYRALMKLSRGNVKVNQKAIKIAWALNKGIKA-EYKQYWDVEIGVTYIPWNKVK 579

  Fly   592 SDTDFDALEEGGMFDEDTM-----PIQMK-QKINQAKNAAKEHKGASIAEAAGAPSV----GVPP 646
            .: |.:...||||.|.||:     |:..| :..:.::|.|.|.||  :.||:.||.|    .:|.
 Frog   580 PE-DLENFCEGGMLDNDTLCPEWKPLAKKPEPKDVSQNGAAETKG--VGEASPAPQVLPLLSIPI 641

  Fly   647 PNLIFGIDTTQPPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGI----------NMPPP 701
            ...|.|:   |.||:.|:  ....|.|..|.|| :..|:|   :.||.|:          .||.|
 Frog   642 RAPIPGM---QVPPLQPM--TAHQPVPSIPTPG-VPTVQG---LPPPQGLPPLQGVPPLQGMPLP 697

  Fly   702 IMMPPTNMPPPMMMP-TTNMPP-----------PMMMPPTMMPPGF-PGIGGPP------HPMAL 747
            ..:||..:|.|..|| ...|||           |...|..:.|||| ||:..||      :||.:
 Frog   698 QGLPPQGLPLPQGMPLPQGMPPHQPIPGMGPLQPPAFPIGIPPPGFAPGVPPPPFMRPGFNPMHM 762

  Fly   748 PPGAPFPPPGAVPP-------PIPSGGQISNSGNVSDDQMDIEMDLEDAPPLP---------PQQ 796
            |||. .||||..||       |:|:.|....:........|...|:....|.|         ..:
 Frog   763 PPGF-LPPPGLPPPMTPPVSIPLPTPGINIPTSTADTSSNDSSKDVSRTNPSPMVPVRDNMEEDE 826

  Fly   797 QAN----FNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRG--PG-------NSRWGGRDDV 848
            :|:    :.|:||....:.....|.:...:..|:.. |..:::|  ||       ....|.|...
 Frog   827 KADNGNGYKPTPSGGPNNAPGPLNPLHGDQQGEQGL-NSGQAQGAHPGPPQGPFSGQPQGPRHGT 890

  Fly   849 VEAAERWRAENG----------------------GGGGGPGSG----------LGPNAAFNEARA 881
            .|.|.:...|..                      |...||..|          |||...     .
 Frog   891 TEGAHQGPQEGSHQGPPEDTDHSPPGGRHYTLPEGPHHGPSEGHHHSPSEGPHLGPTEG-----P 950

  Fly   882 RLNLNPIEHGMPR--------------PDFMDFDNRGGPGGPRGMGPRGNHNG------------ 920
            ||......||.|.              |:.:   :.|.|.||....|.|.::|            
 Frog   951 RLGPEGPHHGPPEGSHHGPQEHPHHGPPEGL---HHGPPEGPHHGTPEGQYHGPPEGPYHGPPEG 1012

  Fly   921 ---GGPGGDFF-PPNMNHNRFNQPTSLMQMRIPPPASFNQRMGGPAG-----NGGNGVGPMFMRN 976
               |.|.|.|. ||   |..::.         ||...|:   |.|.|     :.|...||.....
 Frog  1013 PYHGPPDGPFHGPP---HGPYHG---------PPQGPFH---GPPQGPYQGPHHGPPQGPHHGPP 1062

  Fly   977 QG---GGPGG------AGPSGGGPGGAGTG-----------GGGPG--GRQQGPG--------FF 1011
            ||   |.|.|      .||..|.|.|.|:|           |..||  ..|:.||        |.
 Frog  1063 QGPHHGPPQGPHHGPPQGPHHGPPQGPGSGPHPGPPSTGLLGARPGLIPLQRPPGIPSSNMQRFP 1127

  Fly  1012 NPRNPFNDNQRGRG---GQSG-----GGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGG 1068
            ..:.|...:...||   ||.|     .|:||...|.|..|..||      .||      .|||..
 Frog  1128 MSQRPGPPHMMNRGPPPGQGGFGMPPHGIRGPLLGQGHFPRQRG------PEG------HGGPEE 1180

  Fly  1069 PGGNRFRGER-----GGEMMDDRRGNNSRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEG 1128
            ..|.:|||||     |.|  .||.|..|.|     |.:.||..||.|   .||.:.         
 Frog  1181 RDGRQFRGERPVFPHGRE--PDRFGRRSFG-----RNEDERERFGRR---FDDPDH--------- 1226

  Fly  1129 NKAASETEPKPKNVETELGSTNTGAPAAATRVDTEE--DWDQELQDYEARMEAQKPGERASQSAN 1191
                   |..|....:..|   .|:|:...:.|:||  .|....:     .|...|..|.....|
 Frog  1227 -------ERPPSRGRSSWG---RGSPSRDRQRDSEERNRWPMGHE-----RERGHPRGRGDFLEN 1276

  Fly  1192 SPPQEKLPAENENFAKPADVTGDPLVAKSQTETSAACTPLYDELPPPAVPQTP---TQPPKEPQG 1253
            ..|..:|...::.|:...      ..|::.||..........:.||...|:||   .:..|:|..
 Frog  1277 RKPDAELDENHKPFSSRM------RNAETVTERKEGKAEPAGKNPPEEQPETPKSSEEAEKDPGS 1335

  Fly  1254 SPPRP 1258
            :|.:|
 Frog  1336 NPAKP 1340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 88/118 (75%)
RRM <488..>593 CDD:223796 55/107 (51%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 38/78 (49%)
DUF2413 1147..>1254 CDD:287302 24/112 (21%)
Herpes_DNAp_acc <1206..1304 CDD:282746 12/56 (21%)
scaf4XP_012813473.1 RPR 6..134 CDD:214731 94/128 (73%)
RRM <446..>554 CDD:223796 55/108 (51%)
RRM_SF 475..555 CDD:302621 39/80 (49%)
SelP_N <924..967 CDD:282453 12/48 (25%)
SelP_N <950..1007 CDD:282453 13/60 (22%)
PRP38_assoc <1196..1272 CDD:289628 27/110 (25%)
DUF1777 1197..>1329 CDD:285811 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358651268
eggNOG 1 0.900 E1_KOG0132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.