DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and SCAF4

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_065757.1 Gene:SCAF4 HGNCID:19304 Length:1147 Species:Homo sapiens

Alignment Length:1366 Identity:417/1367 (31%)
Similarity:556/1367 (41%) Gaps:379/1367 (28%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            |:.|.|||.||..|.|.:||||:|||..|||:|::||||||||||.|||||.|||||||||||||
Human     1 MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.|||:|.|||.:|:|.||..|:.|..||||:|:|||||||||.|||.|:|||
Human    66 IDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQP 130

  Fly   131 IFDLADPNHPIYHQMPPVGGSGGQGGGVGPGPSSSGALSLADISSGPNGLNSSGMEISMNSSGGD 195
            :.|:|...    ....||..:.....|..|.|        ..:||.|      ..:.:.||.   
Human   131 LLDMAAGT----SNAAPVAENVTNNEGSPPPP--------VKVSSEP------PTQATPNSV--- 174

  Fly   196 DKMGGAMPDLSLGHEKFGG---------GSSSSKRHYSEQHYSKRQS------------VVSCSS 239
                .|:|.|. ..:.|..         |....:...:.|...|.||            .::...
Human   175 ----PAVPQLP-SSDAFAAVAQLFQTTQGQQLQQILQTFQQPPKPQSPALDNAVMAQVQAITAQL 234

  Fly   240 KTSKSHHHKREYV------KSSHDIDYQVREIIEEEDEGLQMLMADDHHCMGDDS-----PPTSS 293
            ||:.:...:::..      |::.|.....|...::|.|.::....:|...:...:     ||..:
Human   235 KTTPTQPSEQKAAFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKEDTTAVTTTAPAAAVPPAPT 299

  Fly   294 NLLDEKKIKQLLNNP-----------NVLRQLHTL-QNFQNLKPQEENQKHRYQDEALQQ---HF 343
            ..:.........:.|           .:.:..:|. ||....:|:.         ..:||   |.
Human   300 ATVPAAAAPAAASPPPPQAPFGFPGDGMQQPAYTQHQNMDQFQPRM---------MGIQQDPMHH 355

  Fly   344 QNVMKGNAGMPPGMGM---------------------------GMNMNDSMDLN-KDVEFISEQQ 380
            |..:..| |..||.|:                           ....|:.:... ...|...||.
Human   356 QVPLPPN-GQMPGFGLLPTPPFPPMAQPVIPPTPPVQQPFQASFQAQNEPLTQKPHQQEMEVEQP 419

  Fly   381 TIEVINLDGGDSRSPTPDRDRYKRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRS 445
            .|:.:.....|:|          :||  |||.:|||:.|               ||||.|||.||
Human   420 CIQEVKRHMSDNR----------KSR--SRSASRSPKRR---------------RSRSGSRSRRS 457

  Fly   446 SRRRG-SRDRDR---MDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQE 506
            ..||. ||.|||   ..||...:.||||.|||||:||||.:|.|..||||||||||.|.|...|:
Human   458 RHRRSRSRSRDRRRHSPRSRSQERRDREKERERRQKGLPQVKPETASVCSTTLWVGQLDKRTTQQ 522

  Fly   507 ELSDTFGEYGDIVSIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKS 569
            :::....|:|.|.||:.|.|||||:|||..||||::|:|.|.  |:|:..::|.|:||..||:|:
Human   523 DVASLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKA 587

  Fly   570 KEWKDYWDLELGVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQMKQKINQAKNAAKEHKGASIA 634
             ::|.|||:|||||||||.|:..: :.::..||||.|.||:....|....:.:|...::.||..:
Human   588 -DYKQYWDVELGVTYIPWDKVKPE-ELESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNGGAETS 650

  Fly   635 EAAGAPSVGVPPPNLIFGIDTTQPPPVGPVGPVGPP---PGPGAPP--PGLMGMVRGQFPMAPPM 694
            ..  .|...:|.|         .|.||.|: ||..|   |.|..||  ||            ||:
Human   651 HT--EPVSPIPKP---------LPVPVPPI-PVPAPITVPPPQVPPHQPG------------PPV 691

  Fly   695 GINMPPPIMMPPTNMPPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPH--PMALPPGAPFP--P 755
            ...:.||...||..:|||...|....|||   ||..:.|||    .|.|  |..||||.|.|  |
Human   692 VGALQPPAFTPPLGIPPPGFGPGVPPPPP---PPPFLRPGF----NPMHLPPGFLPPGPPPPITP 749

  Fly   756 PGAVPPPIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPP---------------QQQANFNP--S 803
            |.::|||......|.|| .::....|...||....|:|.               :...:..|  :
Human   750 PVSIPPPHTPPISIPNS-TIAGINEDTTKDLSIGNPIPTVVSGARGNAESGDSVKMYGSAVPPAA 813

  Fly   804 PSNVDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAENGGGGGGPGS 868
            |:|:...|......:.                                        |..|..||.
Human   814 PTNLPTPPVTQPVSLL----------------------------------------GTQGVAPGP 838

  Fly   869 GLGPNA-AFNEARARLNLNPIEH--GMPRPDFMDFDNRGGPGGPRGMGPRGNHNG--GGPGGDFF 928
            .:|..| :.....||..|.|::.  |||.|....|...    .||.|.|...|.|  .||||   
Human   839 VIGLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPLM----PPRPMPPHMMHRGPPPGPGG--- 896

  Fly   929 PPNMNHNRFNQPTSLMQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGG 993
                             ..:|||    ..|.||....|..|.|      ||.||..|| |.||||
Human   897 -----------------FAMPPP----HGMKGPFPPHGPFVRP------GGMPGLGGP-GPGPGG 933

  Fly   994 AGTGGG---------------------------GPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGG 1031
            .....|                           .|..:|..|....|:...|||::    |...|
Human   934 PEDRDGRQQPPQQPQQQPQPQAPQQPQQQQQQQPPPSQQPPPTQQQPQQFRNDNRQ----QFNSG 994

  Fly  1032 VRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRG--ERGGEMMDDRRGNN---S 1091
                              .|.|..|..:|          |||...  ||.|...|||..:|   .
Human   995 ------------------RDQERFGRRSF----------GNRVENDRERYGNRNDDRDNSNRDRR 1031

  Fly  1092 RGGRGGP-------REDRERPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKPKNVETELGST 1149
            ..||..|       .|:|.|...|:|...||..:|.|....:|     :..:.||: |....|..
Human  1032 EWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEE-----ARGKEKPE-VTDRAGGN 1090

  Fly  1150 NTGAP--AAATRVDTEEDWDQELQDYEARMEAQKPGERASQSANSPPQEKLPAENENFAKPADVT 1212
            .|..|  :....|||..:.::.:                |::|...|.|:||||..:..:|...:
Human  1091 KTVEPPISQVGNVDTASELEKGV----------------SEAAVLKPSEELPAEATSSVEPEKDS 1139

  Fly  1213 G 1213
            |
Human  1140 G 1140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 87/118 (74%)
RRM <488..>593 CDD:223796 57/107 (53%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 39/78 (50%)
DUF2413 1147..>1254 CDD:287302 16/70 (23%)
Herpes_DNAp_acc <1206..1304 CDD:282746 2/9 (22%)
SCAF4NP_065757.1 RPR 6..134 CDD:214731 93/128 (73%)
DNA_pol3_gamma3 <133..281 CDD:331207 28/174 (16%)
RRM_SCAF4 504..584 CDD:240907 41/80 (51%)
DUF1777 993..>1110 CDD:312240 37/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358646536
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 468 1.000 Inparanoid score I1509
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T608499
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.