DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and nonA-l

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_001262646.1 Gene:nonA-l FlyBaseID:FBgn0015520 Length:630 Species:Drosophila melanogaster

Alignment Length:229 Identity:66/230 (29%)
Similarity:81/230 (35%) Gaps:67/230 (29%)


  Fly   931 NMNHNRFNQPTSLMQMRIPP---------PASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGAGP 986
            |..:....:||       ||         ||....|:||...|||...|       |||.||.|.
  Fly    23 NSTNKNLGKPT-------PPKLNAASDGNPAEKKARLGGNTQNGGGVAG-------GGGTGGGGG 73

  Fly   987 SGGGPGGA-----GTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGG-------VRGVGGGG 1039
            .||..||.     ...||.....:||   |...|..:..|.....:...|       ....||||
  Fly    74 GGGATGGVEFSRNRNRGGNQNENRQG---FQVANNSHQKQINESPKPAAGNVPAKNNELSAGGGG 135

  Fly  1040 GGGPG----GRGRWSDDEDEG--GNNFKRRGG-----------------PGGPGGNR-FRGERGG 1080
            ...|.    |:|...|..::|  |.||:.|||                 ||..|.|: .:|:||.
  Fly   136 QNQPNHSNKGQGNQGDQGEQGNQGPNFRGRGGGPNQPNQNANQEQSNGYPGNQGDNKGGQGQRGA 200

  Fly  1081 EMMDDRRGNNSR--GGRGGPREDRERPGFGNRRG 1112
            .....:|||.||  ||.|......   |.|.:||
  Fly   201 GGGKHQRGNRSRRSGGSGIMNSSM---GGGGQRG 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
nonA-lNP_001262646.1 RRM1_p54nrb_like 264..334 CDD:240778
RRM2_p54nrb_like 339..418 CDD:240779
NOPS_NONA_like 409..508 CDD:240580
OmpH <479..578 CDD:281871
DUF4472 479..559 CDD:291409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23189
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.