DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and scaf8

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_002665299.5 Gene:scaf8 ZFINID:ZDB-GENE-030131-3703 Length:1286 Species:Danio rerio

Alignment Length:1506 Identity:447/1507 (30%)
Similarity:612/1507 (41%) Gaps:443/1507 (29%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            ||.|.|||.||..|.:.:||||||||..|||||::|||.||||||||||||.|||||||||||||
Zfish     1 MEAVKAFNGELYSLNEYKPPISKAKMTQITKSAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.:||:|||||.:|:..||.||:||..:|||:|:||||||||||||||::|||
Zfish    66 IDSIVRQSRHQFGQEKDVFAPRFSKNIIGTFQNLYRCPTDDKSKIVRVLNLWQKNNVFKSDIIQP 130

  Fly   131 IFDLADPNHPIYHQMPPVGGSGG-QGGGVGPGPSSSGA----------------------LSLAD 172
            :.|:|....|  ..:.||..|.. ......||..::.|                      .::|.
Zfish   131 LLDMAAGLPP--PSVTPVSASSVIPMNSTTPGTPATPATPANIVQSLPDWASQISNTDTVAAVAQ 193

  Fly   173 ISSGPNG--LNSSGMEISMNSSGGDDKM-----GGAMPDLSLGHEKFGGGSSSSKRHYSEQHYSK 230
            |...|.|  |......:.|........:     .|.:..|.....:....::::|.:..||..| 
Zfish   194 ILQSPQGQQLQQLVQSLQMQQQKPQPSLLQALDAGLVVQLQALTAQLTAAATANKLNPLEQRVS- 257

  Fly   231 RQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEEDEGLQMLMADDHHCMGDDSPPTSSNL 295
                 |.:.|.........|   |.|..|       .::|.....:             |..|:.
Zfish   258 -----SFNKKLLGQFDFGNE---SEHSED-------SKKDSASSQI-------------PVLSDS 294

  Fly   296 LDEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEENQKHRYQDEALQQHFQNVMKGNA-GMPPGMGM 359
            ::.....||..:    .|...|:.||  |...|:|:|  |.:::....|:.:.|.. ..|.|...
Zfish   295 INSSIFHQLAEH----LQQQNLEQFQ--KQLMEHQQH--QQKSMSMESQDAIFGTENSAPSGQSS 351

  Fly   360 G--------MNMNDSMDLNKDVEFISEQQTIEVINLDGGDSRSPTPDRDRYK---------RSRR 407
            .        ..|:||||        ::||.:::      |......|.:.::         |||.
Zfish   352 APSQHQVQESKMDDSMD--------NQQQDMDI------DEGQDVVDEELFETDEKKTSSTRSRT 402

  Fly   408 NSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGSRDRDRMDRSNR---DKERDRE 469
            .||||:|||             :||.:||||.||..:..:|..||.|||..:|:|   .:.|.||
Zfish   403 RSRSRSRSP-------------KRRRSRSRSGSRKRKHRKRSRSRSRDRKRKSSRSYSSERRARE 454

  Fly   470 HERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIVSIDQIVPRGCAFIVM 534
            .|::|:|||||.|:...|||||||||||.:.|...|::|::.|.|:|.|.||:.|.|||||:|.|
Zfish   455 REKDRQKKGLPPIRSRVLSVCSTTLWVGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYICM 519

  Fly   535 NRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLSSDTDFD 597
            ..||||::|:|.|.  ::|:..:.|.|:||..|||| :|:|.:||::||||||||.|:..| |.|
Zfish   520 VHRQDAYRALQKLSTGSYKIGSKVIKIAWALNKGVK-QEYKQFWDVDLGVTYIPWEKVKLD-DLD 582

  Fly   598 ALEEGGMFDEDTMPIQMKQKINQAKNAAKEHKGASI-AEAAGAPSVG--------------VPPP 647
            ...||||.|::|:....:.:.|  ...|||.....: |||:.|.|..              :|.|
Zfish   583 DFAEGGMIDQETVNNDWESQRN--TETAKETPSQPVKAEASTASSTASEAFTQPVTMMPMQIPVP 645

  Fly   648 NLIFGIDTTQPPPVGPVGPVGPPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPP 712
            ..:..:...  ||..||....||||.|.|||.|..            |.|         .:.|||
Zfish   646 QTVPAVGLV--PPSFPVTMAMPPPGFGPPPPFLRA------------GFN---------ASQPPP 687

  Fly   713 MMMPTTNMPPPMMMPPTMMPPGFPGIGGPPHPMA------LPPGAPFPPPGAVPPP-IPS---GG 767
            ..|.|..:.|..:...|.:......:..|..|..      .|.||..||.|.:|.. |||   |.
Zfish   688 GFMATPGVGPSAVGAVTSLASAQNSLVQPAMPNTQDSSKDSPFGAMMPPTGTIPGSFIPSAMPGA 752

  Fly   768 QISNSGNVSDDQMDIEMDLEDAPPLPPQ-QQANFNPSPSNVDLSPAAMANEMFQQRDRERDRDNR 831
            |:.|                   |:..| ||::.:.:|.:.|...|  ::|:..|          
Zfish   753 QVFN-------------------PVGAQHQQSSTDKTPQSADAMEA--SSEITLQ---------- 786

  Fly   832 DRSRGPGNSRWGGRDDVVEAAERWRAENGGGGGGPG-SGLGPNAAFNEARA---RLNLNPIEHGM 892
                        |..:.|.:             |.| .|:.|:|:.....|   ...|.|:|   
Zfish   787 ------------GMQNAVRS-------------GMGLLGMHPSASLTHPLAGQRMTGLLPLE--- 823

  Fly   893 PRPDFMDFDNRGGPGGPRGMGPRGNHNGGGPGGDF---FPPNMNHN-------------RFNQPT 941
            .||:.:.                      ||||.|   ..|.:.|.             |...|.
Zfish   824 LRPNLLQ----------------------GPGGRFPLLMQPGLAHQTNNVLDASLQAQARLRAPF 866

  Fly   942 SLMQ---------MRIP-PPASFN------------------QRMGG------PAGNGGNGV--- 969
            |.|:         ||.| ||.:.|                  |:.|.      |......|:   
Zfish   867 SQMEQFNRTEGTFMRAPNPPPAVNDSLIKPNNEAPPRSDVVTQQEGDQDYRFPPPEKQSTGLLKT 931

  Fly   970 GPMFMRNQGGGPGGAGPS--GGGPGGAGTGGGGPGGRQQ-----------GPGFFNPRNPFNDNQ 1021
            .|:.||.:   ||.|.|.  ...|..........|.|:.           ||    ||..|  ::
Zfish   932 PPLEMRTE---PGPARPPLLERPPRAVMQAESREGRRENVSAGFRAESRWGP----PRGDF--DE 987

  Fly  1022 RGRGGQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRR-----GGPGGPGGNRFRGERGGE 1081
            |...|.|||..:|.                .|:...|||:.|     ||..||..||..|.....
Zfish   988 RDMRGMSGGSAKGF----------------QEERPNNNFQNRFEGRSGGSSGPTWNRGTGPSFNA 1036

  Fly  1082 MM----DDRRGNNSRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKPKNV 1142
            .|    ||||   ....|...|:||:....|...|     ||||      ..:.......:.:|.
Zfish  1037 NMNQDYDDRR---RPWERQKDRDDRDMDFRGEMNG-----NRHS------RERDRDRERERDRNR 1087

  Fly  1143 ETELGSTNTGAPAAATRVDTEEDWDQELQDYEARMEAQKPGER----ASQS----ANSPPQEKLP 1199
            |.|.|                .|.::| :|.|...|..|..||    :|||    ..:.||..||
Zfish  1088 ERERG----------------RDRNRE-RDRERENEKDKERERWTPLSSQSQPLLPQAKPQPLLP 1135

  Fly  1200 AENENFAKPADVTGDPLVAKSQTETSAACTPLYDELPPPAVPQTPTQPPKEPQGS-PPRP---AP 1260
            .......:|.        |:...:|::..:|:   |.|...||: |:|..|||.. .|.|   :|
Zfish  1136 LPTPLLPRPP--------AQEPVQTNSQSSPV---LHPDPQPQS-TEPAAEPQAEVKPEPQSLSP 1188

  Fly  1261 PV----------------IETEAAPHEE----------SVPAP-----PAELQTEAPSAEEPIAP 1294
            |.                :||::.|..|          |.|.|     ||..:.|.|:.|.|...
Zfish  1189 PEETTSSQEDTAASCVNGMETDSKPQSEPASQTATEPSSSPYPSLTSTPACFENEPPNGENPPEM 1253

  Fly  1295 AASADVVAEAD 1305
            :.||.|.|:|:
Zfish  1254 SVSASVDADAE 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 89/118 (75%)
RRM <488..>593 CDD:223796 56/107 (52%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 38/78 (49%)
DUF2413 1147..>1254 CDD:287302 29/115 (25%)
Herpes_DNAp_acc <1206..1304 CDD:282746 34/133 (26%)
scaf8XP_002665299.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.