DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and Rbm15b

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_017451618.1 Gene:Rbm15b RGDID:1305937 Length:887 Species:Rattus norvegicus

Alignment Length:366 Identity:74/367 (20%)
Similarity:105/367 (29%) Gaps:148/367 (40%)


  Fly   955 NQRMGGPAGNGGNGVGPMFMRN----QGGGPGGAGPSGGG------------PGGAGTGGGGPGG 1003
            |:|...|:|.|.:.........    :.||...|..:.||            |.|:|.|||...|
  Rat     5 NERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGTKHPVPARARDKPRGSGGGGGHRDG 69

  Fly  1004 RQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGG 1068
            |..|          :.|.|...|:|           .|.|||          ||...|..|.||.
  Rat    70 RAAG----------DANHRASSGRS-----------SGAPGG----------GGRTGKASGDPGA 103

  Fly  1069 PGGNRFRGERGGEMMDDRRGNNSRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEGNKAAS 1133
            .|.:                         ||                                ||
  Rat   104 GGAS-------------------------PR--------------------------------AS 111

  Fly  1134 ETEPKPKNVETE-LGSTNTGAPAAATRVDTEEDWDQELQDYEARM--EAQKPGERASQSANSP-- 1193
            ...|.|.....| .|...|.||...|.:.:........:..|.|:  :.::.||.:.:.:::|  
  Rat   112 PLPPPPPPPGAEPAGPGTTAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPEL 176

  Fly  1194 ----------PQEKLPAENENFAK------------PADVTGDPLVAKSQTETSAACTPLYDELP 1236
                      ||:...|.....|:            |..:.|.....:|.:.::||.|      |
  Rat   177 GRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGSSRRSSSSSAAAST------P 235

  Fly  1237 PPAVPQTPTQP----------PKEPQGSPPRPAPPVIETEA 1267
            ||. |.||..|          ..:.:...|..|||:.|..|
  Rat   236 PPG-PPTPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRA 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302 27/143 (19%)
Herpes_DNAp_acc <1206..1304 CDD:282746 20/85 (24%)
Rbm15bXP_017451618.1 RRM1_RBM15B 134..215 CDD:240998 11/81 (14%)
RRM2_RBM15B 325..409 CDD:241000
RRM3_RBM15B 412..487 CDD:241002
SR-25 568..>712 CDD:287471
SPOC 719..854 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23189
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.