DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and seb1

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_593148.1 Gene:seb1 PomBaseID:SPAC222.09 Length:620 Species:Schizosaccharomyces pombe

Alignment Length:760 Identity:156/761 (20%)
Similarity:251/761 (33%) Gaps:226/761 (30%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            |..:..|:..|..|..|:..||.:|:..:|..:|..:......|.||.|:..:....:|:..||:
pombe     1 MSGIAEFDGILDSLEHSKTGISGSKILKLTNLSMENVSENAQFVASVYKYAKRAPVTHKLGALYI 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKS---------------------- 108
            :|||||.  .|.|..|:          .|:|.|     |.|.|                      
pombe    66 LDSIVRS--FQDGAKKN----------NESFEN-----PVDASFSGGWCKAAEITDSLVADAIQH 113

  Fly   109 -------RIIRVLNLWQKNNVFKSEVIQPIFDLADPNHPIYHQMPPVGGSGGQGGGVGPGPSSSG 166
                   :|:::.::|:|.:.|..|.::                                 |...
pombe   114 APSAHLPKILKLCDIWEKASTFPPEKLE---------------------------------SLRS 145

  Fly   167 ALSLADISSGPNGLNSSGMEISMNSSGGDDKMGGAMPDLSLGHEKFGGGSSSSKRHYSEQHYSKR 231
            .|..|..|:.|         :|::|:        |.|..|...|..||...|             
pombe   146 KLKDAMASTEP---------VSVDSA--------AAPSQSTNPEGNGGSVGS------------- 180

  Fly   232 QSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEEDEGLQMLMADDHHCMGDDSPPTSSNLL 296
                ..::.||:...:....:..:.....|...:....:|.:             .:||..:...
pombe   181 ----QAAAPTSRPVENDAASILEALAAFAQKAPVPSAAEESV-------------STPPQPAVAP 228

  Fly   297 DEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEEN--QKHRYQDEALQQHFQNVMKGNAGMPPGMGM 359
            ....:.     ||:.....|..|.|:   |..|  ....:|...:.   |::..|..||..|   
pombe   229 SVSAVV-----PNLPVHPATAINAQS---QSGNPLSNPLFQPSNVP---QSIPSGPMGMKTG--- 279

  Fly   360 GMNMNDSMDLNKDVEFISEQQTIEVINLDGGDSRSPTPDRDRYKRSRRNSRSRTRSPRGRGA--- 421
              ::||           ::.|.|.::|:....: .|....|...::...:.:....|.|.|:   
pombe   280 --SVND-----------TQSQQITLMNVLASQN-VPPAQIDSIMKAAFPNYNAPFQPAGVGSVPL 330

  Fly   422 GGGTGNDRRRRGTRSRSRSRSPRSSRRRGSRDRDRMDRSNRDKERD-----------REHERERR 475
            ...|.:...|.|:..||||.||||.|.|.|.....:...:.....|           |..||:  
pombe   331 PAPTSSQSLRLGSLHRSRSPSPRSGRPRRSPSPSHLSIPSTLPPADGVPKPTPDGFPRRFERD-- 393

  Fly   476 KKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIVSIDQIVPRGCAFIVMNRRQDA 540
                |.|..:.:.|.|.||::|.:::.|.:..|...|..:|.:.|:.........|:.|.||..|
pombe   394 ----PTIPPDSIKVYSRTLFLGGITRSVREPVLRSMFERFGSVQSLILNHNYRHGFLKMFRRDAA 454

  Fly   541 HKAMQALKNHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLSSDTDFDAL---EEG 602
            .||..|::|.......|...|..|.|  .:|..|:   ..|::.|| .:|.:|.|...|   |.|
pombe   455 EKAQVAMENVPFADTTIRTKWGVGFG--PRECSDF---STGISVIP-IRLLTDADRTWLVTAEYG 513

  Fly   603 G----------MFDEDTMPIQM--------KQKINQAKNAAKEHKGASIAEAAGAPSVGVPP--- 646
            |          ..||..:.|.:        |:..:.|....:..:|..       |..|.||   
pombe   514 GTGGLPITPGIALDEPDIEIGLGISSKAISKRGKDFAMRRDERFRGRK-------PYRGGPPIHH 571

  Fly   647 -------PNLIFGIDTTQPPPVGPVGPVGPPPGPG------APPP 678
                   .|...|..:|.|||..|..|..|...|.      :.||
pombe   572 GERHFDSGNDWHGNPSTVPPPTNPYNPGYPYMDPNYSSGYVSQPP 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 34/147 (23%)
RRM <488..>593 CDD:223796 29/105 (28%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 21/76 (28%)
DUF2413 1147..>1254 CDD:287302
Herpes_DNAp_acc <1206..1304 CDD:282746
seb1NP_593148.1 RPR 6..148 CDD:214731 37/192 (19%)
RRM <379..>475 CDD:223796 25/102 (25%)
RRM_NRD1_SEB1_like 403..481 CDD:240777 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1658
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.