DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and Scaf8

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_006227920.2 Gene:Scaf8 RGDID:708362 Length:1532 Species:Rattus norvegicus

Alignment Length:1454 Identity:431/1455 (30%)
Similarity:592/1455 (41%) Gaps:419/1455 (29%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            ||.|..||:||..|.|.:||||||||..|||:|::|||.||||||||||||.|||||||||||||
  Rat   265 MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYV 329

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.:||:|||||..|:..||.||:||..:|||:|:|||||||||||||||:|||
  Rat   330 IDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQP 394

  Fly   131 IFDLA---------------------DPNHPIYHQMPPVGGSGGQGGGVGPGPSSSGALSLADIS 174
            :.|:|                     .|..|:....|.....|.....|....::....::|.|.
  Rat   395 LLDMAAGIPPPVVTPVLASTTAAMSNTPGTPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQIL 459

  Fly   175 SGPNGLN-----------------------SSGMEISMNSSGGDDKMGGA----MPDLSLG---- 208
            ..|.|..                       .:|:.:.:.:.........|    :..|..|    
  Rat   460 QSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTAAAAAANTLTPLDQGVSFT 524

  Fly   209 ---HEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEED 270
               .::|..|..|   .:||:  ||::......|..|:|         .::.|.:|:.|.:::: 
  Rat   525 RKLMDRFDFGEDS---EHSEE--SKKEIPTPQLSHVSES---------VNNSIFHQIAEQLQQQ- 574

  Fly   271 EGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEENQKHRYQ 335
                                   ||  |:..:|||..          |..|.:.|| ::|:..:.
  Rat   575 -----------------------NL--EQLRQQLLEQ----------QQPQKVTPQ-DSQEGAFG 603

  Fly   336 DE--------ALQQHFQNVMKGNAGMPPGMGMGMNMNDSMDLNKDVEFISEQQTI---EVINLDG 389
            .|        :.||||         :.|    ..|::||:|:.:....|.|.|.:   |:..   
  Rat   604 SEHSASPSQGSSQQHF---------LEP----EANLDDSIDIQQQDMDIDEGQDVVEEEIFE--- 652

  Fly   390 GDSRSPTPDRDRY---KRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGS 451
                   |:..:.   .|||.:||||:||||.|.:...:|:.:|:...|||||||    .|:|.|
  Rat   653 -------PEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSR----ERKRKS 706

  Fly   452 RDRDRMDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYG 516
                  .||...:.|.||.|:||:|||||.::.:.|||||||||||.:.|...|::|::.|.|:|
  Rat   707 ------SRSYSSERRAREREKERQKKGLPPVRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFG 765

  Fly   517 DIVSIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLE 579
            .|.||:.|.|||||::.|..|||:.:|:|.|.  ::|:..:.|.|:||..||||: |:|.:||::
  Rat   766 QIESINMIPPRGCAYVCMVHRQDSFRALQKLSSGSYKIGSKVIKIAWALNKGVKT-EYKQFWDVD 829

  Fly   580 LGVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQ---------MKQKINQAKNAAKEHKGASIAE 635
            ||||||||.|:..| |.|...||||.|::|:..:         :|:.:...::.|...|...:. 
  Rat   830 LGVTYIPWEKVKVD-DLDGFAEGGMIDQETVNAEWETVKTSEPVKETVQTTQSPAAVEKETVVT- 892

  Fly   636 AAGAPSVGVPPPNLIFGIDT--TQP-----PPVGPVGPVGPPPG--PGAPPPGLMGMVRGQF-PM 690
               ..|...|||..:..|..  |.|     ||..||....||||  |..|||    .:|..| |.
  Rat   893 ---TQSEVFPPPVTMLQIPVAPTVPAVSLVPPAFPVSMPVPPPGFSPIPPPP----FLRASFNPS 950

  Fly   691 APPMGINMPPPIMMPPTNMPPPM---MMPTTNMPPPM-MMPPTMMPPGF-----PG--IGGPPHP 744
            .||.|. ||||:  ||..:|||.   ::||:.:.||: |.|.|:...||     ||  :.|...|
  Rat   951 QPPPGF-MPPPV--PPPVVPPPAIPPVVPTSLVQPPLSMTPETVKDVGFGSLVLPGGSVAGNLAP 1012

  Fly   745 MALPPGAPFPPPGAVPP----------PIPSGGQISNSGNVSDDQMDIEMDLEDAPPL---PP-- 794
            ..||.|..|.||....|          .||||   .|:..|      |..|:..:.|:   ||  
  Rat  1013 STLPAGNVFNPPSKAEPEEKVPHLTEHQIPSG---ENTRPV------IPSDIPSSAPMLAQPPGA 1068

  Fly   795 --------QQQANFNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRG--------------- 836
                    .|:.|.:.:...:.:.||.::|.......:..:..|.....|               
  Rat  1069 SNTSGILCVQRPNVSSNSEILGVRPANVSNSAAIMGAQPPNMLNNSGILGIQPPNVSSGSGLLGV 1133

  Fly   837 -----PGNSRWGGRDDVVEAAERWRAENGGGGGGPGSGLGPN--------AAFNEARARLNLN-- 886
                 |.||...|       .:.....|..|..|....:||.        |....|...|::.  
  Rat  1134 LPPNLPNNSGLVG-------LQPPNVTNPAGLLGTQPPIGPQNLPPLTIPAQRMPALPMLDIRPG 1191

  Fly   887 -----------------PIEHGMPRPDFMDFDNRGGPGGPRGMG--------------------- 913
                             |.:.|:|.|..:|......|.||...|                     
  Rat  1192 LIAQAPGPRFPLLQPGIPPQRGIPPPSVLDAALHPPPRGPFPPGDLFSQPERPFLAPGRPNIDSV 1256

  Fly   914 -------PRGNHNGGGPGG-DF-FPPNMNHNRFNQPTSLMQMRIPPPASFNQRMGGPAG-NGGNG 968
                   |.||.|....|. |: |||.......|:         |||......:|.|.. ..|.|
  Rat  1257 PNPDKRIPLGNDNIQQEGDRDYRFPPIETREGINR---------PPPVDVRDVVGRPIDPREGPG 1312

  Fly   969 VGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPG----GRQQGPGFFNPRNPFN----DNQRGRG 1025
            ..|:..|:..|.|         |.........||    ||:...| |.|..|:.    |.:..| 
  Rat  1313 RPPLDGRDHFGRP---------PVDMRETLVRPGLDHLGRRDHFG-FPPEKPWGPRDFDEREHR- 1366

  Fly  1026 GQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNN 1090
                  |..|.||..|....|||:.    .|...|..|.||    .||..|:......||||   
  Rat  1367 ------VLPVFGGPKGLHEERGRFR----AGNYRFDPRSGP----WNRGFGQEVHRDFDDRR--- 1414

  Fly  1091 SRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKPKNVETELGSTNTGAPA 1155
                         ||  ..|:..|||.: ........||:...:.            ..||..|.
  Rat  1415 -------------RP--WERQRDRDDRD-FDFCREINGNRLGRDR------------IQNTWVPP 1451

  Fly  1156 AATRVDTEEDWDQELQDYEARMEAQKPGERASQ------SANSPP-----------QEKL----P 1199
            ...||          .||.....:|:.||...|      ..::||           .|||    .
  Rat  1452 PHARV----------FDYFEGATSQRKGENVPQVNGENTERHAPPPPLPVQKDPELYEKLASSGD 1506

  Fly  1200 AENENFAKPADVTGDPLVAKSQTE 1223
            |:.|.....|.|..:.:|..::||
  Rat  1507 ADKEESGTAAGVESEAVVESTETE 1530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 89/118 (75%)
RRM <488..>593 CDD:223796 54/107 (50%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 36/78 (46%)
DUF2413 1147..>1254 CDD:287302 23/99 (23%)
Herpes_DNAp_acc <1206..1304 CDD:282746 5/19 (26%)
Scaf8XP_006227920.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358655051
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 447 1.000 Inparanoid score I1546
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T617432
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
87.750

Return to query results.
Submit another query.