DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and Scaf4

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_001032424.2 Gene:Scaf4 RGDID:727896 Length:1200 Species:Rattus norvegicus

Alignment Length:1414 Identity:422/1415 (30%)
Similarity:548/1415 (39%) Gaps:441/1415 (31%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            |:.|.|||.||..|.|.:||||:|||..|||:|::||||||||||.|||||.|||||||||||||
  Rat     1 MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.|||:|.|||..|:|.||..|:.|..||||:|:|||||||||.|||.|:|||
  Rat    66 IDSIVRQSRHQFGTDKDVFGPRFSENITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQP 130

  Fly   131 IFDLADPNHPIYHQMPPVGGSGGQGG--------GVGPGP-SSSGALSLADISSGPNGLNSSGME 186
            :.|:|            .|.|....|        |..|.| ..|..|..|..:|.|         
  Rat   131 LLDMA------------AGTSNAAPGAENVTNNEGSPPPPVKVSSELPQAPTNSMP--------- 174

  Fly   187 ISMNSSGGDDKMGGAMPDLSLGHEKFGG---------GSSSSKRHYSEQHYSKRQS--------- 233
                          |:|.|. ..:.|..         |....:...:.|...|.||         
  Rat   175 --------------AVPQLP-SSDAFAAVDQLFQTTQGQQLQQILQTFQQPPKPQSPALDSAVMA 224

  Fly   234 ---VVSCSSKTSKSH--HHKREYVKSSHD-IDYQVREIIEEEDEGLQMLMADD-----HHCMGDD 287
               .::...||:.:.  ..|..:.|...| .||      ::|.|.::....:|     ...:...
  Rat   225 QVQAITAQLKTAPTQPPEQKTAFDKKLLDRFDY------DDEPEAVEDSKKEDAVAVATTALATA 283

  Fly   288 SPPT-------------SSNLLDEKKIKQLLNNP--NVLRQLHTL-QNFQNLKP-----QEENQK 331
            :||.             :|:.......:.....|  .:.:..:|. ||....:|     |:::.:
  Rat   284 APPVPAAATPAVAPAVPASSATSPPPPQAPFGYPGDGMQQPAYTQHQNVDQFQPRMMALQQDSMQ 348

  Fly   332 HRY-------------------------------------------------------------- 334
            |:.                                                              
  Rat   349 HQVPLPPNGQMPGFGLLSAPPPFPPMPQPGMPQPGMPQPGMPQPGLSQPGLPQPGMPQPGMPQPG 413

  Fly   335 -------QDEALQQHFQNVMKGNAGMP-PGM---GM---GMNMNDSMDLNKDVEFISE------- 378
                   |....|...........||| |||   ||   ||.....:.......|..:       
  Rat   414 MPQPGMPQPGLAQPGLAQPGMPQPGMPQPGMPQPGMPQPGMPPTPPVQPTFQPTFQPQNEPHSQK 478

  Fly   379 --QQTIEVINLDGGDSRSPTPDRDRYKRSRRNSR-SRTRSPRGRGAGGGTGNDRRRRGTRSRSRS 440
              ||.:||          ..|.....||....|| ||:|||:.|               ||||.|
  Rat   479 PHQQEMEV----------EQPCVTEVKRHVPESRKSRSRSPKRR---------------RSRSGS 518

  Fly   441 RSPRSSRRRG-SRDRDR---MDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSK 501
            ||.||..||. ||.|||   ..||...:.||||.|||||:||||.||.|..||||||||||.|.|
  Rat   519 RSRRSRHRRSRSRSRDRRRHSPRSRSQERRDREKERERRQKGLPQIKSETASVCSTTLWVGQLDK 583

  Fly   502 LVYQEELSDTFGEYGDIVSIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAG 564
            ...|::::....|:|.|.||:.|.|||||:|||..||||::|:|.|.  |:|:..::|.|:||..
  Rat   584 RTTQQDVASLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALN 648

  Fly   565 KGVKSKEWKDYWDLELGVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQMKQKINQAKNAAKEHK 629
            ||:|: ::|.|||:|||||||||.|:.:: :.::..||||.|.||:....|....:.:|...::.
  Rat   649 KGIKA-DFKQYWDVELGVTYIPWDKVKAE-ELESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNG 711

  Fly   630 GASIAEAAGAPSVGVPPPNLIFGIDTTQPPPVGPV-GPVGPPPGPGAPP--PGLMGMVRGQFPMA 691
            ||..:.......:..|.|         .|.|..|| .|:..|| |..||  ||            
  Rat   712 GAEASHTEPVSPIPKPVP---------VPVPALPVPAPITVPP-PQVPPHQPG------------ 754

  Fly   692 PPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPH--PMALPPGAPFP 754
            ||:...:.||...||..:|||...|  .:|||...||....|||    .|.|  |..||||.|.|
  Rat   755 PPVVGALQPPAFTPPLGIPPPGFGP--GVPPPPPPPPPFWGPGF----NPMHLPPGFLPPGPPPP 813

  Fly   755 --PPGAVPPP------IPS--GGQISNSGNVSDDQMDIEMDLEDAP---PLPPQQQANFNPSPSN 806
              ||.::|||      ||:  .|...|:.:....:|........||   |.||..|         
  Rat   814 ITPPVSIPPPHTPPISIPNLVSGARGNAESADSAKMYGSAGPPAAPTSLPTPPVTQ--------- 869

  Fly   807 VDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAENGGGGGGPGSGLG 871
                |.::.                                            |..|..||..:|
  Rat   870 ----PVSLL--------------------------------------------GTQGVAPGPVIG 886

  Fly   872 PNA-AFNEARARLNLNPIEH--GMPRPDFMDFDNRGGPGGPRGMGPRGNHNG--GGPGGDFFPPN 931
            ..| :......|..|.|::.  |||.|....|...    .||.|.|...|.|  .||||      
  Rat   887 LQAPSTGLLGGRPGLIPLQRPPGMPPPHLQRFPMM----PPRPMPPHMMHRGPPPGPGG------ 941

  Fly   932 MNHNRFNQPTSLMQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGT 996
                          ..:|||    ..|.||....|..|.|      ||.||..|| |.||||:..
  Rat   942 --------------FAMPPP----HGMKGPFPPHGPFVRP------GGMPGLGGP-GPGPGGSED 981

  Fly   997 GGG-----------------------------------GPGGRQQ-GPGFFNPRNPFNDNQR--- 1022
            ..|                                   .|...|| .|....|:...|||::   
  Rat   982 RDGRQQQPQQQQQQQQQQQQQQQQQQQQPPPQQSQTQQQPAPSQQPAPAQQQPQQFRNDNRQQFN 1046

  Fly  1023 -GRGGQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDR 1086
             || .|...|.|..|..........|..||:.| ..|..:|..|...|..:|.|..       :.
  Rat  1047 SGR-DQERFGRRSFGSRVENDRERYGSRSDERD-NSNRERREWGRRSPERDRHRDL-------EE 1102

  Fly  1087 RGNNSRGGRGGPREDRERPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKPKNVE---TELGS 1148
            |...|.|.|...|:.|:|.....:..|| ...:|.::....||||          ||   :::|:
  Rat  1103 RSRRSSGHRDRDRDSRDRESRREKEESR-GKEKHEVADRAGGNKA----------VEAPLSQVGN 1156

  Fly  1149 TNTGAPAAATRVDTEEDWDQELQDYEARMEAQKPGERASQSANSPPQEK 1197
            |:|.:               ||...||.....||.|..:::.:|...||
  Rat  1157 TDTVS---------------ELNKGEAMATVVKPEESPAEATSSVEPEK 1190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 87/118 (74%)
RRM <488..>593 CDD:223796 57/107 (53%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 39/78 (50%)
DUF2413 1147..>1254 CDD:287302 13/52 (25%)
Herpes_DNAp_acc <1206..1304 CDD:282746
Scaf4NP_001032424.2 RPR 6..134 CDD:214731 93/128 (73%)
RRM <565..>649 CDD:223796 42/84 (50%)
RRM_SCAF4 570..650 CDD:240907 41/80 (51%)
PRP38_assoc <1046..1115 CDD:289628 20/78 (26%)
DUF1777 1049..>1169 CDD:285811 38/155 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358640966
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T617432
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
87.600

Return to query results.
Submit another query.