DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and Scaf4

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:XP_006523071.1 Gene:Scaf4 MGIID:2146350 Length:1210 Species:Mus musculus

Alignment Length:1449 Identity:433/1450 (30%)
Similarity:553/1450 (38%) Gaps:431/1450 (30%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            |:.|.|||.||..|.|.:||||:|||..|||:|::||||||||||.|||||.|||||||||||||
Mouse     1 MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.|||:|.|||.:|:|.||..|:.|..||||:|:|||||||||.|||.|:|||
Mouse    66 IDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQP 130

  Fly   131 IFDLADPNHPIYHQMPPVGGSGGQGGGVGPGP-SSSGALSLADISSGPN--GLNSS--------- 183
            :.|:|...    ....||..:.....|..|.| ..|..|:.|..:|.|.  .|.||         
Mouse   131 LLDMAAGT----SNAAPVAENVTNNEGSPPPPVKISSELAQAPTNSMPTVAQLPSSDAFAAVAQL 191

  Fly   184 -----GMEISMNSSGGDDKMGGAMPDLSLGHEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSKTS- 242
                 |.::...............|.|                   :.....:...::...||: 
Mouse   192 FQTTQGQQLQQILQTFQQPPQPQSPAL-------------------DSAVMAQVQAITAQLKTAP 237

  Fly   243 ------KSHHHKREYVKSSHDIDYQVREIIEEED------------------------------- 270
                  |:...|:...:..:|.:.:..|..::||                               
Mouse   238 TQPPEQKTAFDKKLLDRFDYDDEPEAVEDSKKEDAAAISTAALATAAPPAPTAATPAVATAVPVP 302

  Fly   271 ----------------EGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPN----VLRQLH 315
                            :|:|......|..| |...|....:..:....|:...||    ....|.
Mouse   303 SATSPPPPQTPFGYPGDGVQQPAYTQHQSM-DQFQPRMMPIQQDTMHHQVPLPPNGQMPGFGLLS 366

  Fly   316 TLQNFQNLKPQEENQKHRYQDEALQQHFQNVMKGNAGMP----------------PGM---GM-- 359
            ....|..:......|....|....|...........|||                |||   ||  
Mouse   367 APPPFPPMPQPGMPQPGMAQPGLAQPGMAQPTMPQPGMPQPGMPQPGMAQPGLAQPGMAQPGMPQ 431

  Fly   360 -----------GM----------------------NMNDSMDLNKDVEFISEQQTIEVINLDGGD 391
                       ||                      |...|...::.||...||..:..:.....:
Mouse   432 PAMPQPAMPQPGMAQPGVSPAPPVQPTFQSTFQPQNEPHSQKPHQQVEMEVEQPCVTEVKRHVPE 496

  Fly   392 SRSPTPDRDRYKRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRG-SRDRD 455
            ||          :||  |||.:|||:.|               ||||.|||.||..||. ||.||
Mouse   497 SR----------KSR--SRSASRSPKRR---------------RSRSGSRSRRSRHRRSRSRSRD 534

  Fly   456 R---MDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGD 517
            |   ..||...:.||||.|||||:||||.||.|..||||||||||.|.|...|::::....|:|.
Mouse   535 RRRHSPRSRSQERRDREKERERRQKGLPQIKSETASVCSTTLWVGQLDKRTTQQDVASLLEEFGP 599

  Fly   518 IVSIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLEL 580
            |.||:.|.|||||:|||..||||::|:|.|.  |:|:..::|.|:||..||:|: ::|.|||:||
Mouse   600 IESINMIPPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKA-DYKQYWDVEL 663

  Fly   581 GVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQMKQKINQAKNAAKEHKGASIAEAAGAPSVGVP 645
            |||||||.|:.:: :.::..||||.|.||:....|....:..|...::.||..:..  .|...:|
Mouse   664 GVTYIPWDKVKAE-ELESFCEGGMLDSDTLNPDWKGIPKKPDNEVAQNGGAETSHT--EPVSPIP 725

  Fly   646 PPNLIFGIDTTQPPPVGPVGPVGPP---PGPGAPP--PGLMGMVRGQFPMAPPMGINMPPPIMMP 705
            .|         .|.||.|: ||..|   |.|..||  ||            ||:...:.||...|
Mouse   726 KP---------VPVPVPPI-PVPAPITVPPPQVPPHQPG------------PPVVGALQPPAFTP 768

  Fly   706 PTNMPPPMMMPTTNMPPPMMMPPTMMPPGFPGIGGPPH--PMALPPGAPFP--PPGAVPPPIPSG 766
            |..||||...|....|||   ||..:.|||    .|.|  |..||||.|.|  ||.::|||....
Mouse   769 PLGMPPPGFGPGVPPPPP---PPPFLRPGF----NPMHLPPGFLPPGPPPPITPPVSIPPPHTPP 826

  Fly   767 GQISNSGNVSDDQMDIEMDLEDAPPLP---------------PQQQANFNP--SPSNVDLSPAAM 814
            ..|.|| .::....|...||....|:|               .:...:..|  :|:::...|...
Mouse   827 ISIPNS-TIAGINEDTTKDLSIGNPIPTVVSGARGNAESGDSAKMYGSAGPPAAPTSLPTPPVTQ 890

  Fly   815 ANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAENGGGGGGPGSGLGPNA-AFNE 878
            ...:.                                        |..|..||..:|..| :...
Mouse   891 PVSLL----------------------------------------GTQGVAPGPVIGLQAPSTGL 915

  Fly   879 ARARLNLNPIEH--GMPRPDFMDFDNRGGPGGPRGMGPRGNHNG--GGPGGDFFPPNMNHNRFNQ 939
            ..||..|.|::.  |||.|....|...    .||.|.|...|.|  .||||...||  .|.    
Mouse   916 LGARPGLIPLQRPPGMPPPHLQRFPMM----PPRPMPPHMMHRGPPPGPGGFAMPP--PHG---- 970

  Fly   940 PTSLMQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGG----------------------GPG 982
                |:...||...| .|.||..|.||.|.||....::.|                      .|.
Mouse   971 ----MKGPFPPHGPF-VRPGGMPGLGGPGPGPGASEDRDGRQQQPQQQPPPQQQQQQQQPQQQPP 1030

  Fly   983 GAGPSGGGPGGAGTGGGGPGGRQQGPGFFN-PRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPGGR 1046
            ...|| ..|..|         :||.|.|.| .|..||.   || .|...|.|..|..........
Mouse  1031 QQSPS-QQPAPA---------QQQPPQFRNDSRQQFNS---GR-DQERFGRRSFGSRVENDRERY 1081

  Fly  1047 GRWSDDEDEGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNNSRGGRGGPREDRERPGFGNRR 1111
            |..:||.| ..|..:|..|...|..:|.|..       :.|...|.|.|...|:.|:|.  ..|.
Mouse  1082 GSRNDDRD-NSNRERREWGRRSPDRDRHRDL-------EERSRRSSGHRDRDRDSRDRE--SRRE 1136

  Fly  1112 GSRDDSNRHSISSTDEGNKAASETEPKPKNVETELGSTNTGAPAAATRVDTEEDWDQELQDYEAR 1176
            ...:...:|.::....||||          ||..|....|        :||.    .||...||.
Mouse  1137 KEENRKEKHEVADRAGGNKA----------VEPPLSQVGT--------IDTV----SELNKGEAM 1179

  Fly  1177 MEAQKPGERASQSANSPPQEKLPAENENFAKPADVTGDPLVAKSQTETSAACTPLYDELPPPAVP 1241
            ....||.|                      .||:||                             
Mouse  1180 ATVVKPEE----------------------SPAEVT----------------------------- 1193

  Fly  1242 QTPTQPPKEPQGS---PPR 1257
             :|..|.|:| ||   |||
Mouse  1194 -SPVGPEKDP-GSAAEPPR 1210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 87/118 (74%)
RRM <488..>593 CDD:223796 57/107 (53%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 39/78 (50%)
DUF2413 1147..>1254 CDD:287302 19/107 (18%)
Herpes_DNAp_acc <1206..1304 CDD:282746 13/56 (23%)
Scaf4XP_006523071.1 RPR 6..134 CDD:214731 93/128 (73%)
penta_MxKDx <389..444 CDD:131998 10/55 (18%)
RRM <565..>649 CDD:223796 42/84 (50%)
RRM_SCAF4 570..650 CDD:240907 41/80 (51%)
PRP38_assoc <1049..1119 CDD:289628 22/82 (27%)
DUF1777 1060..>1168 CDD:285811 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358651416
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 472 1.000 Inparanoid score I1487
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T615324
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
109.680

Return to query results.
Submit another query.