DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and mdt-15

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_741152.1 Gene:mdt-15 WormBaseID:WBGene00007016 Length:780 Species:Caenorhabditis elegans

Alignment Length:743 Identity:160/744 (22%)
Similarity:213/744 (29%) Gaps:261/744 (35%)


  Fly   636 AAGAPSVGVPPP-----------NLIFGIDTTQ--PPPVGPVGPVGPPPGPGAPPPGLMGMVRGQ 687
            |.|.|....|.|           |....:.|||  ..|..| .|.|..|.|.|.....:......
 Worm   101 AGGTPGYRAPVPPDPQPTSAQARNPPVTVATTQASTTPSAP-NPPGGLPAPSASATAAVAAAVAS 164

  Fly   688 FPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMP-----------PPMMMPPTMMPPGFPGIGGP 741
            || :|...|. |...:.|.:..|.....|..|:|           |.|..||..|  |.|.:|||
 Worm   165 FP-SPDTSIR-PGGQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQM--GAPNMGGP 225

  Fly   742 PH------PMALPPGA---------------------PFPPP----------GAVPPPIPSG--G 767
            |:      .|..|||:                     |:.|.          ||:||..|.|  |
 Worm   226 PNGYGGYGMMNGPPGSGAPMGGNPYNQQIKKDMDQARPWDPSAHMYQQQPQWGAMPPQQPHGYPG 290

  Fly   768 Q-ISNSGNVSDDQMDIEMDLEDAPPLPPQQQANFN----PSPSNVDLSPAAMANEMFQQRDRERD 827
            : ::..|........:   ||.....|.|...:.|    |...||....||...:..||:.:::.
 Worm   291 RPMNGQGATPTGPSSV---LESLINQPQQYPGHHNQMGPPGDRNVAAQRAAAQQQQQQQQQQQQQ 352

  Fly   828 RDNRDRSRGPGNSR------------WGGRDDVVEAAERWRAENGGGGGGPGSGLGPNAAFNEAR 880
            |.....::|..:|.            .|..|.:...|.:.|.|            |.:.|.::..
 Worm   353 RPGMVPNQGMMSSEDQTVYSAKLRNMRGSCDSLRTRARQCRHE------------GNHEAAHKLE 405

  Fly   881 ARLN------------LNPIEHGMPRPDFMDFDNRGGPGGPRGMGPRGNHNGGGPGGDFFPPNMN 933
            ..|:            ||.:|..:.|.  .||.|         :.|...             |.|
 Worm   406 VMLSVLEGKRVVSLEYLNHLEMWIARK--QDFLN---------IAPMSQ-------------NQN 446

  Fly   934 HNRFNQPTSLMQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGG 998
            |...|.|                .|.|.....|||..|             .|.||.||      
 Worm   447 HMGMNDP----------------MMNGEHAMLGNGQVP-------------NPYGGHPG------ 476

  Fly   999 GGPGGRQQGPGFFNPRNPF----------------------NDNQRGRGGQSGGGVRGVGGGGGG 1041
               .|.||   :..|..|.                      .|:...:||  ||.|.|:..|..|
 Worm   477 ---YGHQQ---YMGPPPPHMQMHQPPMWHQQQHQQQQRMMPQDHMMMQGG--GGPVHGMYRGDMG 533

  Fly  1042 -----GPGGRGRWSDDEDEGG--NNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNNSRGGRGGPR 1099
                 .|....|.:...:...  ||.:...|||..|.:| ....|..|.....|..|....|.|.
 Worm   534 HDPMTSPVNNHRHAPYPNPAAMRNNMRMPNGPGPIGRDR-NSMSGSSMSGPSSGAPSMNPMGTPN 597

  Fly  1100 EDRERPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKPKNVET-----ELGSTNTGAPAAATR 1159
            :....||........||.|             ..:..|.|..::.     .:|..:..|.....|
 Worm   598 QKMGTPGSMGGMSGLDDLN-------------YDDFLPNPTPIDALQPTLHVGQNSMNAGPPVQR 649

  Fly  1160 VDTEEDWDQELQDYEARMEAQKPGERASQSANS------------PPQEKL-----PAENENFAK 1207
            .:..|...:|||..:||.|.....:|  ..||.            ||...:     ||.|     
 Worm   650 SNLNETARKELQILDARFEIDPNHQR--HDANHIIVVCKIRNQQFPPLRLVVPTTYPAGN----- 707

  Fly  1208 PADVTGDPLVAKSQTETSAACTPLYDEL 1235
               ||.|..|......       |||:|
 Worm   708 ---VTVDRAVIDLDAY-------LYDDL 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621
RRM <488..>593 CDD:223796
RRM_SCAF4_SCAF8 490..566 CDD:240673
DUF2413 1147..>1254 CDD:287302 26/107 (24%)
Herpes_DNAp_acc <1206..1304 CDD:282746 8/31 (26%)
mdt-15NP_741152.1 Med15 13..780 CDD:255446 160/744 (22%)
KIX_2 <39..75 CDD:293592
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23189
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.