DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and nrd-1

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_491403.1 Gene:nrd-1 WormBaseID:WBGene00017004 Length:988 Species:Caenorhabditis elegans

Alignment Length:1419 Identity:343/1420 (24%)
Similarity:481/1420 (34%) Gaps:561/1420 (40%)


  Fly     1 METVV--AFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGL 63
            |||.|  :||||||.|:||: .:||.|:..|||:|::|...|||||.||||.|.||||:.::..|
 Worm     1 METEVMKSFNNELSSLFDSK-NMSKNKIQDITKAAIKAKSQYKHVVFSVEKLINKCKPDQRLNVL 64

  Fly    64 YVIDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVI 128
            ||||||||.|:||. .:||.|.|||.:...:....|.:|..::|.|.:|.||||..|.|||...|
 Worm    65 YVIDSIVRASKHQL-KEKDTFGPRFMKQFDKFLMPLLKCGQKEKMRTVRTLNLWMSNKVFKESEI 128

  Fly   129 QPIFDL---------------------ADPN--HPIYHQMPPVGGSGGQ------------GGGV 158
            ||:.::                     ||.:  ..:|.:.|....|..|            .|.:
 Worm   129 QPLREMCKASGLTIDFEEVELAVKGKQADMSIYSGVYKKKPKRSSSSSQPKSRTPTNPHPDDGLL 193

  Fly   159 GPGPSSSGALSLADISSGPN---------GLNSSGMEISMNSSGGDDKMGGAMPDLSL---GHEK 211
            |.||||: ..|:.||   ||         |..|....:.:....|.|:.|....|.:|   ..:.
 Worm   194 GAGPSSA-LRSVPDI---PNFVLSEDYFLGTISEREMLELVQKFGIDRSGVLSKDKNLLQRALQI 254

  Fly   212 FGGG-SSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEEDEGL-- 273
            |.|. |...:...:|.:.....|:.:..:|..       ||   |.|.:.:.:|...|:.:.|  
 Worm   255 FAGSLSQKVEEVLAENNRINGSSIQNVLTKDF-------EY---SDDEEEKEKEPQPEKQKNLPH 309

  Fly   274 -------QMLMADDHHCM------------------GDDSPPTSS----------NLLDEKKI-- 301
                   |.|:.......                  |:...||||          ||:..::.  
 Worm   310 AQVLLLAQSLLTQPQILAKLAEVLIPQGNPFGLPFPGEHIVPTSSAALTLGAPPPNLMALQQSLP 374

  Fly   302 ----KQLLNNPNV--LRQLHTLQNFQNLKPQEENQKHRYQDEALQQH---FQN-VMKGNAGMPP- 355
                .|.|..||:  |.|.. |.|.||.:...:.|:...|.:|||.:   .:| :|.||..:.| 
 Worm   375 PGFPNQQLGLPNLSGLNQAQ-LMNVQNAQNMLQLQQRAAQLQALQGNPNAQRNLLMLGNPLLNPF 438

  Fly   356 GMGMGMN--MNDSMDLNKDVEFISEQQTI----------EVINLDGGDSRSPTPDRDRYKRSRRN 408
            .:..|:|  :||     ......::||.:          :::.|.||:|                
 Worm   439 ALQHGVNPMLND-----LQAAAAAQQQAMLNEAAQSPEKKILELSGGNS---------------- 482

  Fly   409 SRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGSRDRDRMDRSNRDKERDREHERE 473
                           |..|.                     |..:|.|:    |:||::|| .:|
 Worm   483 ---------------GINNS---------------------GDVERARL----REKEKERE-SKE 506

  Fly   474 RRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIVSIDQIVPRGCAFIVMNRRQ 538
            ||:.|||.::.....:.|.|||:..:...:.:.:|.......|:...:..|..|.||:|.|..|:
 Worm   507 RRRMGLPPVRIGFTIIASRTLWLKKIPTNIVENDLKQAVESCGEASRVKVIGNRACAYITMENRR 571

  Fly   539 DAHKAMQALKNHKLQGRAITISWAAGKGVKSKEWKDYWDLELGVTYIPWSKLSSDTDFDALEEGG 603
            .|:..:..::...:..:.:.:.||...|:.|.::.|.||...||..||:.||  ..|..||.||.
 Worm   572 SANDVVSKMREVSVAKKMVKVYWARSPGMDSDQFSDLWDSNRGVLEIPYEKL--PLDLVALCEGA 634

  Fly   604 MFDEDTMPIQMKQKINQAKNAAKEHKGASIAEAAGAPSVGVPPPNLIFGIDTTQPPPVGPVGPVG 668
            |.|.:::||:.|                .:.:..|...:.:||||:       ||       ||.
 Worm   635 MLDIESLPIEKK----------------LLYKETGETVISIPPPNI-------QP-------PVP 669

  Fly   669 PPPGPGAPPPGLMGMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPMMMPPTMMPP 733
            .||..|.|....:..:.||           |.|..:|| .:||   |...|.||         ||
 Worm   670 HPPPMGFPFQHQLTQLPGQ-----------PRPAGLPP-GVPP---MFNLNAPP---------PP 710

  Fly   734 GFPGIGGPPHPMALPPGAPFPPPGAVPPPIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPPQQQA 798
            |.||.  ||.|         ||||..||| |.|                         :||.   
 Worm   711 GIPGY--PPAP---------PPPGVGPPP-PQG-------------------------IPPM--- 735

  Fly   799 NFNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGGRDDVVEAAERWRAENGGGG 863
                                                                             
 Worm   736 ----------------------------------------------------------------- 735

  Fly   864 GGPGSGLGPNAAFNEARARLNLNPIEHGMPRPDFMDFDNRGGPGGPRGMGPRGNHNGGGPGGDFF 928
                 |..||..                 |.|.|....|.|.|..|.|       .|.||...|.
 Worm   736 -----GFDPNKP-----------------PPPMFQQGFNAGAPPPPFG-------RGAGPMSSFP 771

  Fly   929 PP---NMNHNRFNQPTSLMQMRIPPPASFNQRMGGPAGNGGNGVGPMFMRNQGGGPGGAGPSGGG 990
            ||   .|:|             :|||.||.   ||..|:|| ...|.|.|..||||         
 Worm   772 PPPRGGMHH-------------MPPPPSFR---GGRGGHGG-PPPPHFDRRGGGGP--------- 810

  Fly   991 PGGAGTGGGGPGGRQQGPG-FFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGPGGRGRWSDDED 1054
                      |...:.|.| ..:....:|..||...          ||||.|..|||.....|.|
 Worm   811 ----------PFRPENGRGRLLDQSEMWNREQREMR----------GGGGAGRDGGREHRDYDRD 855

  Fly  1055 EGGNNFKRRGGPGGPGGNRFRGERGGEMMDDRRGNNSRGGRGGPREDRERPGFGNRRGSRDDSNR 1119
            ....:.:|:...|..     |..|.|:  ||||.::.|               .:||..|.:|.|
 Worm   856 RSQIDRRRQDDMGAR-----RRSRWGD--DDRRDDDRR---------------DDRRDDRRESRR 898

  Fly  1120 HSISSTDEGNKAASETEPKPKNVETELGSTNTGAPAAATRVDTEEDWDQELQDYEARMEAQKPGE 1184
            .|..|              |:            :|...||                         
 Worm   899 RSPRS--------------PR------------SPDRRTR------------------------- 912

  Fly  1185 RASQSANSPPQEKLPAENENFAKPADVTGDPLVAKSQTETSAACTPLYDELPPPAVPQTPTQPPK 1249
                  .||..|:               .:|.|.|:..|.....:...|||.|...|        
 Worm   913 ------RSPSYER---------------EEPPVKKTSVEEETVSSTTLDELKPSVEP-------- 948

  Fly  1250 EPQGSPPRPAPPVIETEAAPHEESVPAPPAELQTEAPSAEEPIAPAASADVVAE 1303
                 .|.|||             :|||..||:    :||||:      .:|||
 Worm   949 -----TPVPAP-------------IPAPAPELK----AAEEPV------KIVAE 974

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 62/118 (53%)
RRM <488..>593 CDD:223796 27/105 (26%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 16/76 (21%)
DUF2413 1147..>1254 CDD:287302 15/107 (14%)
Herpes_DNAp_acc <1206..1304 CDD:282746 25/99 (25%)
nrd-1NP_491403.1 RPR 8..136 CDD:214731 65/130 (50%)
RRM_SCAF4_SCAF8 523..599 CDD:240673 16/76 (21%)
RRM <524..>597 CDD:223796 16/73 (22%)
Drf_FH1 <738..>787 CDD:283903 22/86 (26%)
Extensin_2 740..>787 CDD:252669 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358609013
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 269 1.000 Inparanoid score I1818
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T475474
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.875 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
1110.690

Return to query results.
Submit another query.