DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4266 and Scaf8

Sequence 1:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster
Sequence 2:NP_598884.2 Gene:Scaf8 MGIID:1925212 Length:1268 Species:Mus musculus

Alignment Length:1485 Identity:429/1486 (29%)
Similarity:592/1486 (40%) Gaps:481/1486 (32%)


  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65
            ||.|..||:||..|.|.:||||||||..|||:|::|||.||||||||||||.|||||||||||||
Mouse     1 MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYV 65

  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130
            |||||||||||:|.:||:|||||..|:..||.||:||..:|||:|:|||||||||||||||:|||
Mouse    66 IDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQP 130

  Fly   131 IFDLA---------------------DPNHPIYHQMPPVGGSGGQGGGVGPGPSSSGALSLADIS 174
            :.|:|                     .|..|:....|.....|.....|....::....::|.|.
Mouse   131 LLDMAAGIPPPVVTPVLASTTAAMSNTPGTPVTPVTPANVVQGLPDPWVSQIANTDTLAAVAQIL 195

  Fly   175 SGPNGLN-----------------------SSGMEISMNSSGGDDKMGGA----MPDLSLG---- 208
            ..|.|..                       .:|:.:.:.:.........|    :..|..|    
Mouse   196 QSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTAAAAAANTLTPLDQGVSFN 260

  Fly   209 ---HEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEED 270
               .::|..|..|   .:||:  ||::......|..|:|         .::.|.:|:.|.:::: 
Mouse   261 KKLMDRFDFGEDS---EHSEE--SKKEMPTPQLSHVSES---------VNNSIFHQIAEQLQQQ- 310

  Fly   271 EGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEENQKHRYQ 335
                                   ||  |:..:|||..          |..|.:.|| ::|:..:.
Mouse   311 -----------------------NL--EQLRQQLLEQ----------QQPQKVTPQ-DSQEGTFG 339

  Fly   336 DE--------ALQQHFQNVMKGNAGMPPGMGMGMNMNDSMDLNKDVEFISEQQTI---EVINLDG 389
            .|        :.||||         :.|    ..|::||:|:.:....|.|.|.:   |:..   
Mouse   340 SEHSASPSQGSSQQHF---------LEP----EANLDDSIDIQQQDMDIDEGQDVVEEEIFE--- 388

  Fly   390 GDSRSPTPDRDRY---KRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGS 451
                   |:..:.   .|||.:||||:||||.|.:...:|:.:|:...||||.|   |..:|:.|
Mouse   389 -------PEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSHS---REKKRKAS 443

  Fly   452 RDRDRMDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYG 516
                   ||...:.|.||.|:||:|||||.::.:.|||||||||||.:.|...|::|::.|.|:|
Mouse   444 -------RSYSSERRAREREKERQKKGLPPVRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFG 501

  Fly   517 DIVSIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLE 579
            .|.||:.|.|||||::.|..|||:.:|:|.|.  ::|:..:.|.|:||..||||: |:|.:||::
Mouse   502 QIESINMIPPRGCAYVCMVHRQDSFRALQKLSSGSYKIGSKVIKIAWALNKGVKT-EYKQFWDVD 565

  Fly   580 LGVTYIPWSKLSSDTDFDALEEGGMFDEDTMPIQ---------MKQKINQAKNAAKEHKGASIAE 635
            ||||||||.|:..| |.|...||||.|::|:..:         :|:.:..|::.|...|.:.:..
Mouse   566 LGVTYIPWEKVKVD-DLDGFAEGGMIDQETVNAEWETVKASEPVKEPVQTAQSPAPVEKESVVTT 629

  Fly   636 AAGAPSVGVPPPNLIFGIDTTQP-------PPVGPVGPVGPPPG--PGAPPPGLMGMVRGQF-PM 690
            .|..    .|||..:..|.....       ||..||....||||  |..|||    .:|..| |.
Mouse   630 QAEV----FPPPVAMLQIPVAPAVPAVSLVPPAFPVSMPVPPPGFNPIPPPP----FLRASFNPS 686

  Fly   691 APPMGINMPPPIMMPPTNMPPPM---MMPTTNMPPPMMMPP----------TMMPPGFPGIGGPP 742
            .||.|. ||||:  ||..:|||.   ::||:.:.||:.|.|          .::|.|  .:.|..
Mouse   687 QPPPGF-MPPPV--PPPVVPPPAIPPVVPTSLVQPPLSMTPEAVKDVGFGSLVLPSG--SVAGSL 746

  Fly   743 HPMALPPGAPFPPPGAVPP----------PIPSGGQISNSGNVSDDQMDIEMDLEDAPPLPPQQQ 797
            .|..||.|..|.||....|          .||||                    |:..|:     
Mouse   747 APSTLPAGNVFNPPSKAEPEEKVPHLIEHQIPSG--------------------ENTRPV----- 786

  Fly   798 ANFNPSPSNVDLSPAAMANEMFQQRDRERDRDNRDRSRGPGNSRWGG-----RDDVVEAAERWRA 857
                 .||::..|.|.:|                   :.||.|...|     |.:|...:|.   
Mouse   787 -----IPSDIPSSAAMLA-------------------QPPGASSTSGILCVQRPNVSSNSEI--- 824

  Fly   858 ENGGGGGGPGSGLGPNAAFNEARARLNLNPIEHGMPRPDFMDFDNRGGPGGPRGMGPRGNHNGGG 922
                      .|:.|....|.| |.:...|       |:.::      ..|...:.|....:|.|
Mouse   825 ----------LGVRPANVSNSA-AIMGAQP-------PNILN------NSGILAIQPPNVSSGSG 865

  Fly   923 PGGDFFPPNMNHN---------RFNQPTSLM-------QMRIPPPASFNQRMGGPA--------G 963
            ..| ..|||:.:|         ....|..|:       ...:||.|...|||  ||        |
Mouse   866 LLG-VLPPNLPNNSGLVGLQPPNVTSPAGLLGTQPPIGPQNLPPLAIPAQRM--PALPMLDIRPG 927

  Fly   964 NGGNGVGPMFMRNQGGGPGGAG--------------PSGGGPGGAGTGGGGPGGRQQGPG--FFN 1012
            ......||.|...|.|.|...|              |.|..|                ||  |..
Mouse   928 LIAQAPGPRFPLLQPGIPPQRGIPPPSVLDAALHPPPRGPFP----------------PGDLFSQ 976

  Fly  1013 PRNPF---------------------NDNQRGRGG--------QSGGG--------VRGVGG--- 1037
            |..||                     |||.:..|.        ::..|        ||.|.|   
Mouse   977 PERPFLAPGRPSIDNVPNPDKRIPLGNDNIQQEGDRDYRFPPIETREGITRPPQVDVRDVVGRRL 1041

  Fly  1038 GGGGGPG----------GR-----------------GR-----WSDDEDEGGNNFKRR------- 1063
            ....|||          ||                 ||     :..::..|..:|..|       
Mouse  1042 DPREGPGRPPLDARDHFGRPPVDMRENLVRPSLDHLGRRDHFGFPPEKPWGPRDFDEREHRVLPV 1106

  Fly  1064 -GGPGGPGGNRFRGERGGEMMDDRRGNNSRG-GRGGPR--EDRERPGFGNRRGSRDDSNRHSISS 1124
             |||.|....|.|...|....|.|.|..:|| |:...|  :||.||  ..|:..|||.: .....
Mouse  1107 FGGPKGLHEERGRFRAGNYRFDPRSGPWNRGFGQEVHRDFDDRRRP--WERQRDRDDRD-FDFCR 1168

  Fly  1125 TDEGNKAASETEPKPKNVETELGSTNTGAPAAATRVDTEEDWDQELQDYEARMEAQKP------- 1182
            ...||:...:.            ..||..|....||          .||.....:|:.       
Mouse  1169 EINGNRLGRDR------------IQNTWVPPPHARV----------FDYFEGATSQRKGDNVPQV 1211

  Fly  1183 -GERASQSANSPP---------QEKLPA----ENENFAKPADVTGDPLVAKSQTE 1223
             ||...:.|..||         .|||.:    :.|.....|.|..:.:|..::||
Mouse  1212 NGENTERHAQPPPLPVQKDPELYEKLASSGDVDKEESGTVAGVESEAVVESTETE 1266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4266NP_001097394.1 CID 7..125 CDD:239621 89/118 (75%)
RRM <488..>593 CDD:223796 54/107 (50%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 36/78 (46%)
DUF2413 1147..>1254 CDD:287302 22/99 (22%)
Herpes_DNAp_acc <1206..1304 CDD:282746 5/19 (26%)
Scaf8NP_598884.2 CID 4..125 CDD:239621 90/121 (74%)
RRM <473..>552 CDD:223796 37/79 (47%)
RRM_SCAF8 475..553 CDD:240908 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358638343
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 472 1.000 Inparanoid score I1487
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T615324
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
109.680

Return to query results.
Submit another query.