DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG5506

DIOPT Version :10

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:132 Identity:36/132 - (27%)
Similarity:57/132 - (43%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 VPPNALEGGFDS-SEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAG---GG 227
            :|.||:.||||. ....|:.|.::...::|.::....|..|............|::|.|.   ..
  Fly    37 IPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKLLVYDILVAERDVNY 101

  Fly   228 QWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGK-VQPSHGCCYIPYGGEELAYKEFE 291
            .|:....|.....|:..|.|.:.|.:|..||..||.|.:|. :..|...|.|.:  |.||.::|:
  Fly   102 VWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLSSQKVCIIKH--ESLALRKFD 164

  Fly   292 IY 293
            .|
  Fly   165 KY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505
DUF3421 177..287 CDD:463390 27/114 (24%)
CG5506NP_649021.1 DUF3421 48..161 CDD:463390 27/114 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.