DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10527 and CG44251

Sequence 1:NP_611544.1 Gene:CG10527 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_725246.1 Gene:CG44251 FlyBaseID:FBgn0265186 Length:478 Species:Drosophila melanogaster

Alignment Length:318 Identity:93/319 (29%)
Similarity:131/319 (41%) Gaps:82/319 (26%)


  Fly     2 PIEVNTPDKLEYQFFPASGGVFTFKVRSPKDAHLALTPAPEENGPIFEIFLGGWENTKSVIRKDR 66
            |....|||.:     |..|||..  :.||       ||.|...|               |:...|
  Fly   203 PAYTPTPDPM-----PPVGGVMV--MPSP-------TPPPPAGG---------------VLVMPR 238

  Fly    67 QKP---------------------EVAEVPTPGILDAGEFRGFWVRWYDNVITVGREGDAAAFLS 110
            ..|                     |||  |.|..:.| |....      :|........|:.:..
  Fly   239 PPPPPPPAGGVLVMPPPPPSFTPAEVA--PPPSFVPA-EVTAV------SVPVAPSFTPASTYNP 294

  Fly   111 YDAGSLFPVNFVGICTGWGASGTWLIDEPAPSA-PVMGFAAPTGSGPGCWVPAANG-EVPPNALE 173
            |:||          |:.:..:     :..|||| ...|:    |:....||.|..| ...|:|:.
  Fly   295 YEAG----------CSSYTPA-----ECAAPSAYDAYGY----GNNYDVWVSAEPGYYYSPDAVI 340

  Fly   174 GGFDSS-EQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGG-QWLPVDAGN 236
            ||.||: |||.:.||.:.|..:|||..||.|..|:|.||.|.....|::|...|. .|:|...||
  Fly   341 GGHDSNMEQLLVCRAYYRGVHVPGKAIPSQGCGYIAHGGREIIEPSYQMLVGKGKYHWVPSYGGN 405

  Fly   237 IPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV 294
            :||.|:.||.|..|.||:|||..:.|::|.|.::..:.|..||:||:|:....:|:.|
  Fly   406 VPPGAVVAGTTPGGAPLYIGRGHYCGSLTPGVIETYNRCLQIPFGGQEIRLSNYEVLV 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052 20/119 (17%)
DM9 156..225 CDD:128937 29/71 (41%)
DUF3421 180..286 CDD:288732 45/107 (42%)
DM9 226..296 CDD:128937 28/71 (39%)
CG44251NP_725246.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732
DM9 74..144 CDD:128937
DM9 322..393 CDD:128937 29/71 (41%)
DUF3421 344..455 CDD:288732 47/111 (42%)
DM9 396..464 CDD:128937 27/69 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131156082
eggNOG 1 0.900 E1_28P3B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.