DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10527 and CG32633

Sequence 1:NP_611544.1 Gene:CG10527 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001259517.1 Gene:CG32633 FlyBaseID:FBgn0052633 Length:285 Species:Drosophila melanogaster

Alignment Length:234 Identity:80/235 (34%)
Similarity:111/235 (47%) Gaps:40/235 (17%)


  Fly    70 EVAEVPTPGILDAGEFRGFWVRWYDNVITVGREGDAA---AFLSYDAGSL-----FPVNFVGICT 126
            |..||| ||                 .:.|||..|..   |...|.||||     .|        
  Fly    81 ENGEVP-PG-----------------AVKVGRNVDGEYLYAGRGYHAGSLTMGKVHP-------- 119

  Fly   127 GWGASGTWLIDEPAPSAPVMGFAAPTGSGPGCWVPAANGEVPPNALEGGFDSS-EQLYIARARHE 190
               :.|...|  |..|..|..||......|..|:......:|..||..|.||: :.:|:.|....
  Fly   120 ---SHGCLYI--PYDSDEVKIFAYEVLC
QPERWIDTTATNIPDGALVAGHDSNGDTIYVGRVFRN 179

  Fly   191 GDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFI 255
            |||:|.|:.|:.|..|.|:...||...:.:||...|.:|:|...||:.|.||.:|...:||||::
  Fly   180 GDLLPAKVVPAKGKAYAAYAQAEHELTDVQVLTGSGFRWVPASHGNVAPGALSSGPNVDGEPLYV 244

  Fly   256 GRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV 294
            |||.:..:::|||:.|||||.|||:||||:..:.:|:.|
  Fly   245 GRAIYCDSLSVGKIHPSHGCIYIPFGGEEVRLENYEVLV 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 35..133 CDD:289052 18/71 (25%)
DM9 156..225 CDD:128937 23/70 (33%)
DUF3421 180..286 CDD:288732 46/106 (43%)
DM9 226..296 CDD:128937 33/70 (47%)
CG32633NP_001259517.1 DM9 3..73 CDD:128937
DUF3421 24..134 CDD:288732 22/84 (26%)
DM9 74..142 CDD:128937 24/92 (26%)
DUF3421 165..275 CDD:288732 48/110 (44%)
DM9 215..284 CDD:128937 33/70 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131156201
eggNOG 1 0.900 E1_28P3B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR31649
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.