DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10527 and CG44250

DIOPT Version :10

Sequence 1:NP_611544.1 Gene:CG10527 / 37393 FlyBaseID:FBgn0034583 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001163133.1 Gene:CG44250 / 19836034 FlyBaseID:FBgn0265185 Length:297 Species:Drosophila melanogaster


Alignment Length:153 Identity:69/153 - (45%)
Similarity:96/153 - (62%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MGFAAPTG--SGPGCWVPAA-NGEVPPNALEGGFDSSE-QLYIARARHEGDLIPGKLHPSHGVTY 206
            ||...|.|  :....||.:: ...:||.|:.||.||.. .:|:.|:.|||:.:|.|:.||.|..|
  Fly     1 MGAVQPGGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAY 65

  Fly   207 VAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQP 271
            ||:||.||....||||...|..|:|..:|.:||||:.:|.|..||||::||..|.|::|||||.|
  Fly    66 VAYGGAEHTKTHYEVLVGQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHP 130

  Fly   272 SHGCCYIPYGGEELAYKEFEIYV 294
            ||||.|||:||:|:....:|:.:
  Fly   131 SHGCLYIPFGGQEVRINTYEVLI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10527NP_611544.1 Methyltransf_FA 34..132 CDD:463505
DUF3421 177..287 CDD:463390 57/110 (52%)
CG44250NP_001163133.1 DUF3421 36..146 CDD:463390 56/109 (51%)
DUF3421 179..288 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.