DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3295 and AT4G37880

Sequence 1:NP_611536.1 Gene:CG3295 FlyBaseID:FBgn0034573 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_195501.1 Gene:AT4G37880 AraportID:AT4G37880 Length:388 Species:Arabidopsis thaliana

Alignment Length:426 Identity:122/427 (29%)
Similarity:214/427 (50%) Gaps:45/427 (11%)


  Fly    10 SVEKDLTRVVSKLEQLHENAEADIGDIATQMSELVEVLSRAEQLVTTLNSSTQVSQDDPMGDAVS 74
            |::....||.:|.:..:           ::.:|:|.:||:      .::.:..:.::.|..|.:.
plant     5 SIKDAFDRVATKQKLSY-----------SKTNEIVHMLSQ------EIDKALSILEETPSSDTML 52

  Fly    75 MQVETEPTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM 139
            :.        .|.....|:.|...:|    .:.:|....::||.:::|..|.:::..:.|.|...
plant    53 LD--------HRSILADVKKVFMEIA----PITQLEATEKELHAALTKYPKVLEKQLNPDISKAY 105

  Fly   140 RVDVLQDEENLMLLNKAIAKHYCRQGMDDVARTLIRECKMSPEHAQDVFDSEREFADIYGIWVKI 204
            |.:|   |.:..::|:.||..:.||||.|:.     :|.:: |..:....:.:.|.::|.|...:
plant   106 RHNV---EFDTHIVNQIIANFFYRQGMFDIG-----DCFVA-ETGESECSTRQSFVEMYRILEAM 161

  Fly   205 QKRDLTDALKWAKMYSQQLSDRHSLIEFRLHRMRFMQLVSYGLDSQREAISYARLNFKKFAVRYE 269
            ::|||..||.||...|.:|.:..|.:|.:||.:.|:: ::.|.:| :|||.|||.:...||....
plant   162 KRRDLEPALNWAVSNSDKLKEARSDLEMKLHSLHFLE-IARGKNS-KEAIDYARKHIATFADSCL 224

  Fly   270 HEIANLMASFIYLPSGLENSPYKHFLGQEKWTELSFIFLKDACQLLGISKNSALSVVVNAGCTAL 334
            .||..||.|.:: ...|:.|||..||....|........:..|.|||.|..|.||:.|.||..||
plant   225 PEIQKLMCSLLW-NRKLDKSPYSEFLSPALWNNAVKELTRQYCNLLGESSESPLSITVTAGTQAL 288

  Fly   335 PALLNIKQVMQSRQVLGMWNGCDELPIEIDLQPEFRFHSIFACPILRQQTSEDNPPKKLTCGHVI 399
            |.||....|:.:.:.|. |...::||::..|..||:|||:|.||:.::|:|:||||..::||||:
plant   289 PVLLKYMNVVMANKKLD-WQTMEQLPVDAQLSEEFQFHSVFVCPVSKEQSSDDNPPMMMSCGHVL 352

  Fly   400 SNDALHKLSVG---HILKCPYCPVEQNAEEAVRIYF 432
            ....::|:|..   ...||||||.:.:.....:::|
plant   353 CKQTINKMSKNGSKSSFKCPYCPTDVDISRCRQLHF 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3295NP_611536.1 COG5109 88..432 CDD:227440 110/347 (32%)
LisH 152..181 CDD:128913 9/29 (31%)
CTLH 193..250 CDD:128914 19/57 (33%)
CRA 252..343 CDD:214806 36/91 (40%)
zf-RING_UBOX 377..416 CDD:290181 16/42 (38%)
AT4G37880NP_195501.1 CLTH 150..292 CDD:313761 54/145 (37%)
dRing_Rmd5p_like 328..375 CDD:319566 20/47 (43%)
degenerated RING finger 330..374 CDD:319566 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H5668
Inparanoid 1 1.050 191 1.000 Inparanoid score I1340
OMA 1 1.010
OrthoDB 1 1.010 D987270at2759
OrthoInspector 1 1.000 T124642
orthoMCL 1 0.900 OOG5_128648
Panther 1 1.100 LDO PTHR12170
Phylome 1 0.910 0.800 Consistency score
98.980

Return to query results.
Submit another query.