DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9346 and u2surp

Sequence 1:NP_611535.1 Gene:CG9346 FlyBaseID:FBgn0034572 Length:957 Species:Drosophila melanogaster
Sequence 2:NP_001184003.1 Gene:u2surp ZFINID:ZDB-GENE-070912-400 Length:968 Species:Danio rerio

Alignment Length:1027 Identity:451/1028 (44%)
Similarity:611/1028 (59%) Gaps:149/1028 (14%)


  Fly    13 AASATLKRISEKKLEAFTVG--TFSKRQLSKKELEDQKKKEDAAAAAHAFKEFVETFQDAPTPSS 75
            |.....|.:.|.||:||::|  ..:||.|||||.::.|||||..|||..::||:..|:.. ....
Zfish     9 AQKGNSKALLESKLKAFSIGKMAVAKRTLSKKEQDEIKKKEDERAAAEIYEEFLAAFEGG-EGKV 72

  Fly    76 KVWVKAGTYDAGSRREDKS---EKGKLYKPVSKLMEKSSSDKVEDYAKTLASDLKKDSGPLKKKN 137
            |.:|:.|.  |.:.:|:.:   :|||||||.|:::|..|...:|...:.|..|.:..|   ||.:
Zfish    73 KTFVRGGI--ANATKEEAAADEKKGKLYKPKSRIVEAKSFLPLETPQQFLPIDKRNAS---KKGD 132

  Fly   138 QEKKKSNLELFKEELRQIQEEREERHKYKHMASSHSAPAQQPAASAAPVPS-----SSVSTTSQN 197
            :||||||||||||||:||||||:|||:.|...|...           |:|:     ||..::.:|
Zfish   133 KEKKKSNLELFKEELKQIQEERDERHRLKGRVSRFE-----------PLPTTEGRRSSDGSSRRN 186

  Fly   198 SSSS----KESGSFDTGDPNTTNLYLGNLNPKISEQQLMEIFGRYGPLASIKIMWPRSEEEKQRG 258
            ..||    ...||.|.|||.||||||||:||:::|:.|.:.|||||||||:||||||::||:.|.
Zfish   187 RPSSVLDDSAPGSHDVGDPTTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARE 251

  Fly   259 RNCGFVAYMSRKDAERALKTLNGRYIMGYEMRLGWGKTVPIMNTPIFTPQALLEMTLPPPPSGLP 323
            |||||||:|:|:|||||||.|||:.||.:||:|||||.|||...||:.|.:::|.||||||||||
Zfish   252 RNCGFVAFMTRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLP 316

  Fly   324 FNAQPP-----PSEADVLPKKNYKEFNQEDKENMERILAKCVVKVHIPTEKAVLNVIHRMIEFVI 383
            |||||.     |:.|...|.|        .||..|:.|::.:|||.||||:.:|::||||||||:
Zfish   317 FNAQPKERLKNPNAAMPPPPK--------CKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVV 373

  Fly   384 REGPMFEALIMIREMENPLFAFLFDNESPAHIYYRWKLFSLLQGDTPNEWREEEFRMFKNGPVWK 448
            ||||||||:||.||:.|||:.|||:|:||||:||||||:::|||::|.:|:.|:|||||||.:|:
Zfish   374 REGPMFEAMIMNREINNPLYRFLFENQSPAHVYYRWKLYTILQGESPTKWKTEDFRMFKNGSLWR 438

  Fly   449 PPIANFYTQGMP--DELVVDPDAPVVHKGALSNAQRNRLEDLIRHLTPERARIGDAMIFCIEHAD 511
            ||..|.|..|.|  :|...|.|..:..||:|.:.:|::||:|:|.|||.::.|...|.||:.|||
Zfish   439 PPPLNPYLHGTPEDEEHEDDDDEEICKKGSLKDEERDKLEELLRGLTPRKSDIAGGMFFCLTHAD 503

  Fly   512 AADEICECIAESLSNINTLASKKIARLYLISDILHNCTVKVANASFFRKSVEKQLLDIFDNLHNY 576
            ||:||.||||||||.:.|...||||||||:||:|:|.:.||.|||::||..|.:|..||.:|:..
Zfish   504 AAEEIVECIAESLSILKTPLPKKIARLYLVSDVLYNSSAKVTNASYYRKFFETKLCQIFSDLNAT 568

  Fly   577 YLNIESRLKAEGFKSRVCNVIRTWEEWTIYPKDFMAQLTAKFLG----KPYVKPVNNSPQAEETR 637
            |..|:..|::|.||.||.:..|.||||.:||..|:.:|...|||    .|..:|....|:..|. 
Zfish   569 YKTIQGHLQSENFKQRVMSCFRAWEEWAVYPDPFLIKLQNIFLGLVSLDPEKEPEELVPELPEK- 632

  Fly   638 FDEALDEDIDGAPLSGEEKDD---EDLDGVPLDGAALLKSALKRAIPDADAGTPKRDTPKKDEYL 699
                 .|||||||:..||.|.   :|:||:|:|||                       |.....:
Zfish   633 -----VEDIDGAPIVEEELDGAPLDDVDGMPIDGA-----------------------PIDGASM 669

  Fly   700 DEIDGIPL---DDDLDGVPLEKETKSTAKLPGF--IPSKWETVDPQQVEAQAITTSKWDTLDPPD 759
            |::||:|:   |||||||||:::       |||  .|||||.||...:||||:|||||:..|.|:
Zfish   670 DDLDGMPIKGADDDLDGVPLDQK-------PGFKVAPSKWEAVDGAALEAQAVTTSKWEIFDLPE 727

  Fly   760 PP-----------------KFFSSDDDSGEDNP--QKY----------TDEMRQKLRDIESKAIQ 795
            ..                 |..|:.|.....||  ::|          ::|.|.|||:||.|.::
Zfish   728 ESEKSKSSTKSEAEGKNSHKSSSAADQQSYSNPVREEYDLKSAKFSETSEEKRAKLREIELKVMK 792

  Fly   796 YQDELESGKRRLEPGWSVPEQVEQFRKRLLKQDSRSEATVDSPLSYMHIKSKSSKVSESPALFRS 860
            :|||||||||..:.|.|:.||||.:|.:||:::...|...|....    |.|..|..|...:|..
Zfish   793 FQDELESGKRPKKSGQSIQEQVELYRDKLLQREKEKETEKDKEKE----KEKERKDKEKSDVFHK 853

  Fly   861 SSRKRSHSPFSGGESKRRDYSPETSRS-SKSSKRNRSRSPSS--SPKRYTERSSRSSRYETP--- 919
            ...|...:|  |.:.|:|.:||..|.: |.||:|.||.||.|  |.:.||..||||:..::|   
Zfish   854 EKDKDESTP--GRKEKKRRHSPSPSPTRSSSSRRGRSPSPRSERSDRSYTRDSSRSAYKDSPRES 916

  Fly   920 -ASGSSRSRSSPTSSRSSRREEPSPPR-------------HRSDKHKHKHRH 957
             ...|.||.|.|.:.:.|||.....|:             |||.|...|.:|
Zfish   917 NRKSSKRSPSPPRTPKRSRRSRSRTPKKASKKSRSRSRSPHRSHKKSKKSKH 968

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9346NP_611535.1 RRM_SR140 214..297 CDD:240669 58/83 (70%)
Surp 373..423 CDD:280053 37/50 (74%)
RPR 480..619 CDD:214731 70/139 (50%)
cwf21 784..827 CDD:285507 24/43 (56%)
u2surpNP_001184003.1 RRM_SR140 207..290 CDD:240669 58/83 (70%)
Surp 364..412 CDD:280053 37/48 (77%)
VHS_ENTH_ANTH 476..611 CDD:295355 69/135 (51%)
cwf21 782..823 CDD:285507 24/41 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C318317724
eggNOG 1 0.900 E1_KOG0151
Hieranoid 1 1.000
Homologene 1 1.000 H13964
Inparanoid 1 1.050 745 1.000 Inparanoid score I549
OMA 1 1.010
OrthoDB 1 1.010 D280924at33208
OrthoFinder 1 1.000 FOG0003185
OrthoInspector 1 1.000 T598019
orthoMCL 1 0.900 OOG5_129457
Panther 1 1.100 LDO PTHR23140
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4207
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.