DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prosalpha3 and Prosalpha2

Sequence 1:NP_476691.1 Gene:Prosalpha3 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster

Alignment Length:235 Identity:92/236 (39%)
Similarity:126/236 (53%) Gaps:16/236 (7%)


  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLD--SAIPSEKIY 66
            ||....|.|||.|:|.|:|||:.|:|.....:||:|.:|:::|.|.:..:.|.:  |....|.||
  Fly     5 RYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIY 69

  Fly    67 RLNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFG 131
            . :..||.|  |:..|..:|..:.|.|||.|..:|.|.||..|||..:..:.|.|||.||.||||
  Fly    70 N-HIGMVYS--GMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFG 131

  Fly   132 VSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLA 196
            ||||..||||...| ||||||||.|..||||.:|.|.....:.|::..::    .|.|.||...|
  Fly   132 VSLLICGWDNDRPY-LYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSE----DLELDDAVHTA 191

  Fly   197 IKVLSMTLDTTKLTPEKVEMAT-----LQRVDNKTVYSVL 231
            |..|....: .|:|.:.:|:..     .||:|..::...|
  Fly   192 ILTLKEGFE-GKMTADNIEIGICDQNGFQRLDPASIKDYL 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 92/236 (39%)
proteasome_alpha_type_4 3..219 CDD:239721 88/222 (40%)
Prosalpha2NP_524328.1 PRK03996 6..233 CDD:235192 91/235 (39%)
proteasome_alpha_type_2 6..231 CDD:239719 91/235 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78930945
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.