DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgt3 and grdn-1

Sequence 1:NP_611533.2 Gene:dgt3 FlyBaseID:FBgn0034569 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001256816.1 Gene:grdn-1 WormBaseID:WBGene00013082 Length:1319 Species:Caenorhabditis elegans

Alignment Length:589 Identity:129/590 (22%)
Similarity:225/590 (38%) Gaps:150/590 (25%)


  Fly    27 EQMEMFFKFLSGNITDANILTERQVLEREEMQRR-GEWLSASDREL-KLLQIEAESPGLLNYKQQ 89
            |::.:..:.:|..:.:.|:..:..|.:..|.:|: ||:.....|:| :....|.|....::.|.:
 Worm   497 ERIGIELEEMSAQVENLNLERDEAVKQLLEARRKFGEFQMGQSRDLEEKWSKEVEKSNKISKKCE 561

  Fly    90 DVDALTMSIEAIEDASRDYATLLEDMMTTKHSITKHLGEVECVTAELQ-----LREKDLIAECQS 149
            .::......:.:...|||.|..|:      ..:.:.|.|...||..|.     |:.|.|..:.|.
 Worm   562 ILEEKLQESDFLLAKSRDEAKKLQ------FELDEALEETSHVTRSLSSEKNTLKAKLLELQDQV 620

  Fly   150 KAKQLEELQQENCRLSAEAKKAFTAPQLPPLFMHQL--PLEQYFHKCDSFMQYFTLYVKENFKIQ 212
            :|:.||.|.|:||....|.:....:.      :|.|  .||.....|.:.::.      |:.|: 
 Worm   621 EAQTLELLNQKNCGKRLEDRDQMISN------LHNLKNELENDLKTCQTQLEL------ESKKL- 672

  Fly   213 DYDEFQSAEEDLGREKAKLEDLERGIQFYALSYIRTKA---KVKATQCLIDQLDLGKIHCLSLTD 274
                 |...|||..||::..||...|.....:.....|   |:.....|||.:|  .|...:|..
 Worm   673 -----QRLREDLVLEKSRRADLIGRIHSLCTTLSLNGANFEKINNDDELIDNID--DIMMNALVA 730

  Fly   275 MAREMHDLQLLNDYQLSNTHD-------------TLLNDLTIHIQQ------HTQRRIELVLYEN 320
            :.||..||::..:.|:...||             ..||:....:::      ||:.::.::..:.
 Worm   731 VKRERDDLRIQGNQQIQELHDLKRDIEKLRRSESESLNESDDRVRELTRENMHTKEQVFMLQEKL 795

  Fly   321 TKLKLERAVRRHESDKKLTKI-------ISDALSNAELLWI-------AIQLDCDKKRNCLDTSE 371
            .:|.||.:.:..|.|.....|       .:...||||:..:       .||.|..|:.|     .
 Worm   796 RELNLELSTKNDEIDMVKASIEELNRNSTASCTSNAEIARLQVSIRNSQIQEDLVKQEN-----T 855

  Fly   372 ELRDQAQATWQRIQTMRSINASYQGICAQFVQEIANLLSAHLGQNIKATEAKACLFEYEKFGRLL 436
            :|||:.| ..|::...||.|          :.|:.|:   |          |..|.::.:..:| 
 Worm   856 KLRDELQ-EMQKMSKKRSQN----------LDELENM---H----------KTLLVDHSRLQQL- 895

  Fly   437 SYSFQSMLNRKSCAAVQDQLAELKRLEQTLRPFVYDSPLEQPMF--ENVRYLSAIYNVTQQQTRL 499
                .::|.|        ...|.|:....||..|.:.|.:|.:|  .|:|.|.|  .::::.:|.
 Worm   896 ----HNLLTR--------DYDEAKKESMELRQKVQNIPRQQAVFMNANIRELEA--KLSEEISRR 946

  Fly   500 DESGR----------SLRKDFLENVVGRIERDKLYRYSVVLWIWFLTEPQRMMH--------AID 546
            ::..:          :||:|..|.|..|.|               |:...|..|        .||
 Worm   947 EQLEKEHKMCRIHCENLRRDITELVQTRDE---------------LSLELRRAHDTCHNKNNQID 996

  Fly   547 EVKK 550
            |:||
 Worm   997 ELKK 1000

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgt3NP_611533.2 HAUS-augmin3 22..257 CDD:317356 53/242 (22%)
grdn-1NP_001256816.1 SMC_N 281..1083 CDD:330553 129/590 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.