DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rx and repo

Sequence 1:NP_726006.3 Gene:Rx FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster

Alignment Length:715 Identity:171/716 (24%)
Similarity:255/716 (36%) Gaps:270/716 (38%)


  Fly   310 GANGANPPPA-PLPPSSFGSHQQHLAA---LAAQAQEQQNQHSKYAKSS--PTGAGPPPPPGAYF 368
            |....||..| ||.|::...|...|.:   |.:|.|:||.|......::  |.|.|.....|.  
  Fly    15 GGGPLNPLGAKPLMPTTTAMHPVMLGSVHELCSQQQQQQQQQRLPDCNTILPNGGGGGAGSGG-- 77

  Fly   369 MESQTAPVAPSQINYDERSMSSASDLEEDDDDAAKLQLDVTSPP---TPSPRGQ-LAAKRKSAGV 429
                 |..:|:.:.                      :||..:..   :||.:.: ::|.:|.   
  Fly    78 -----AGGSPNYVT----------------------KLDFVNKMGCYSPSQKYEYISAPQKL--- 112

  Fly   430 FCDDNEPKLANGQLPGGNYGIRPRSMEEVHHQQQSH--------------HHQQQQQQQQQQQQL 480
                                :..:..::.|||...|              |.|..||||||||||
  Fly   113 --------------------VEQQQQQQHHHQHHQHYTATPPPSHNGILLHKQSSQQQQQQQQQL 157

  Fly   481 -------------------------QQQQ----GFQHDFRNSGNGNP-----------NGNS--- 502
                                     ||.|    |..|...:..:|:.           ||.|   
  Fly   158 VGILDYHPLNGKLDYSSSPKDQYEPQQLQHLYGGSPHHLDHLDHGSDGLLQDSSPVMINGGSAGG 222

  Fly   503 ------------NSGDHGERLNADSDSLVNGSCASSEDLNQTNSSE---QGEKITSG-------- 544
                        .:|..|....:.|.::|||:...:.:.|.::|:.   ||...|:|        
  Fly   223 KLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAK 287

  Fly   545 ----SDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQV 605
                |..:..|.|..|||  :.|||||.|||.|||||||::.||||::|||||:|:||.|.||||
  Fly   288 KDGSSSKKKGDPNGIKKK--KTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQV 350

  Fly   606 WFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYP 670
            ||||||||||:.|.              |.:.|...:..|....|:|..|:  |.|.|:|||   
  Fly   351 WFQNRRAKWRKHEP--------------PRKTGYIKTSTPPTATLNPGTLA--PPFTSYPQT--- 396

  Fly   671 SYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVV 735
            :.:|||.|       |.|..:                               :..|:        
  Fly   397 TTVTPPGS-------MDSWTS-------------------------------YQTPY-------- 415

  Fly   736 PLSHLSPHLSRMSPHATSLG--SPHHG-------VTPL-----GTPLHSSLPPSSTATTVAVSSS 786
               .|:|..|.:||.|:..|  |..:|       :.|:     |:|....:  .:|..:||.:..
  Fly   416 ---ELTPQFSLLSPAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEM--GATTGSVAGNGD 475

  Fly   787 QSSSSSASLECSGPDVCMSPQNLSIG------------NADSNGDGRDLSSD----------LDA 829
            :|.::..|.:.:....... |.|:.|            ......:|:.||::          ...
  Fly   476 ESVANGGSYQTAELQTAQQ-QQLADGTLVTVHAHQQQQQQQQQLNGKYLSAEEAKYVHLQCHQSG 539

  Fly   830 GSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSS---TPPTDMRSNSIATLRIKAKE 891
            |....:||:|.....|.....:           .|.||..:|   |...|..|..:.|: ||::|
  Fly   540 GGLELSPGASCHLVEAQGQHYV-----------TTATGGAASAGGTSSDDNDSGGMQTV-IKSEE 592

  Fly   892  891
              Fly   593  592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 41/52 (79%)
OAR 876..892 CDD:281777 6/17 (35%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 36/47 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24329
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.