DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rx and rx3

Sequence 1:NP_726006.3 Gene:Rx FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio

Alignment Length:413 Identity:128/414 (31%)
Similarity:164/414 (40%) Gaps:185/414 (45%)


  Fly   498 PNGNSNSGDHGERLN--ADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHR 560
            |.|:..:|...|.|:  .||:...:|.|.|:..::.......|.|:   ||||.     .|||||
Zfish    51 PYGSGKTGKDTEHLSPKKDSNKHFDGVCRSTVMVSPDLPDADGGKL---SDDEN-----PKKKHR 107

  Fly   561 RNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSE--SL 623
            ||||||||:||||||||||||||||||||||||:|||||||||||||||||||||||||.|  |:
Zfish   108 RNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSI 172

  Fly   624 RLGLTHFTQLPHR--LGCGASGLPVDPWLSPPL------LSALPGFLSHPQTVYPSYLTPPLSLA 680
            :|..:....:|..  |..| ||||::|||:.|:      |.:||.|:: ||...|:..|||..|:
Zfish   173 KLQESSMLSIPRSGPLSLG-SGLPLEPWLTGPISTSSSPLQSLPSFIT-PQQAVPASYTPPQFLS 235

  Fly   681 PGNLTMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLSPHLS 745
            ...                                                     |:|..||:.
Zfish   236 SST-----------------------------------------------------LNHSLPHIG 247

  Fly   746 RMSPHATSLGSPHHGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLS 810
            .:.|       |:                                     :|||           
Zfish   248 AVCP-------PY-------------------------------------QCSG----------- 257

  Fly   811 IGNADSNGDGRDLSSDLDAGSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPT 875
                                        .:||                           .|....
Zfish   258 ----------------------------FMDK---------------------------FSLQEA 267

  Fly   876 DMRSNSIATLRIKAKEHLDNLNK 898
            |.|:.|||:||:|||||:.::.|
Zfish   268 DPRNTSIASLRMKAKEHIQSIGK 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 50/52 (96%)
OAR 876..892 CDD:281777 11/16 (69%)
rx3NP_571302.1 Octapeptide motif 32..39
Homeobox 110..162 CDD:278475 50/52 (96%)
OAR 268..284 CDD:281777 11/16 (69%)
OAR. {ECO:0000255|PROSITE-ProRule:PRU00138} 272..285 10/13 (77%)
Nuclear localization signal. {ECO:0000255} 278..282 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCKD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T598018
orthoMCL 1 0.900 OOG5_132221
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.