DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rx and Alx4

Sequence 1:NP_726006.3 Gene:Rx FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 RGDID:1310201 Length:399 Species:Rattus norvegicus

Alignment Length:649 Identity:149/650 (23%)
Similarity:206/650 (32%) Gaps:302/650 (46%)


  Fly   262 THHGHAPF-GYHNAFGFG-------QGGHGYGHPEEAAGNYLNSMHQMVEANQLQTGANGANPPP 318
            :..|.:|| |:.....||       ..|.|:|   :|.|.                         
  Rat    27 SREGSSPFRGFPGGDKFGTTFLSAAAKGQGFG---DAKGR------------------------- 63

  Fly   319 APLPPSSFGSHQQHLAALAAQAQEQQNQHSKYAKSSPTGAGPPPPPGAYFMESQTAPVAPSQINY 383
                 :.:|:.||.|||........:...:|:....||   |.|||         ||.||....|
  Rat    64 -----ARYGAGQQDLAAPLESNAGARGSFNKFQPQPPT---PQPPP---------APPAPPAHLY 111

  Fly   384 DERSMSSASDLEEDDDDAAKLQLDVTSPPTPSPRGQLAAKRKSAG------VFCDDNEPKLANGQ 442
            .:|.             |.|         || |.|.|..:..|.|      |.|...|..|...:
  Rat   112 LQRG-------------ACK---------TP-PDGSLKLQEGSGGHNAALQVPCYAKESNLGEPE 153

  Fly   443 LPGGNYGIRPRSMEEVHHQQQSHHHQQQQQQQQQQQQLQQQQGFQHDFRNSGNGNPNGNSNSGDH 507
            ||       |.|                                          .|.|..||   
  Rat   154 LP-------PDS------------------------------------------EPVGMDNS--- 166

  Fly   508 GERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDD----EGQDDNCAKKKHRRNRTTFTT 568
                                .|:...:..:|.:..:|::.    |..|...:|.|.||||||||:
  Rat   167 --------------------YLSVKETGAKGPQDRAGAEIPSPLEKTDSESSKGKKRRNRTTFTS 211

  Fly   569 YQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQL 633
            |||.|||:.|:|:||||||:||:|||:.:|.|.||||||||||||||::|:...::...|||:  
  Rat   212 YQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFS-- 274

  Fly   634 PHRLGCGASGLPVDPWLSPPLLSALPGFLSHPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAH 698
                                                .:|..|.|:.|.....:.:          
  Rat   275 ------------------------------------TAYELPLLTRAENYAQIQN---------- 293

  Fly   699 NGPPPPHVGHGGHGQPQPPPPPPPHGVPHPHGSHHVVPLSHLSPHLSRMSPHATSLGSPHHGVTP 763
                |..:|:.|...|.|....|...||                  :.|||||            
  Rat   294 ----PSWIGNNGAASPVPACVVPCDPVP------------------ACMSPHA------------ 324

  Fly   764 LGTPLHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDLSSDLD 828
                 |   ||.|.|::|:                        ..||:..|.|:.....:.|.. 
  Rat   325 -----H---PPGSGASSVS------------------------DFLSVSGAGSHVGQTHMGSLF- 356

  Fly   829 AGSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGSSTPPTDMRSNSIATLRIKAKEH 892
             |:...:||.:               |.:....|             |.:::|||.||:|||||
  Rat   357 -GAAGISPGLN---------------GYEMNGEP-------------DRKTSSIAALRMKAKEH 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 39/52 (75%)
OAR 876..892 CDD:281777 10/16 (63%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 39/52 (75%)
OAR 375..392 CDD:281777 11/18 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24329
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.