DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rx and ARX

Sequence 1:NP_726006.3 Gene:Rx FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX HGNCID:18060 Length:562 Species:Homo sapiens

Alignment Length:671 Identity:161/672 (24%)
Similarity:224/672 (33%) Gaps:262/672 (39%)


  Fly   318 PAPL-------------PPSSFGSHQQHL--------------------AALAAQAQEQQNQHSK 349
            ||||             |.||....:..|                    ||.||.|.......:.
Human    51 PAPLTSRADPEKAVQGSPKSSSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAAA 115

  Fly   350 YAKSSPTGAGPPPPP------------GAYFMESQTAPVAPSQINYDERSMSSASDLEEDDDDAA 402
            .|.:.|.|..|||||            ||....:..|..|...:...:....|.|..:...::.|
Human   116 TATAGPRGEAPPPPPPTARPGERPDGAGAAAAAAAAAAAAWDTLKISQAPQVSISRSKSYRENGA 180

  Fly   403 KLQLDVTSPPTPSPRGQLAAKRKSAGVFCDDNEPKLAN--GQLPGGNYGIRPRSMEEVHHQQQSH 465
            ..     .||.|:    |.......||...:....:|.  |..|....|......||...:.:..
Human   181 PF-----VPPPPA----LDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEED 236

  Fly   466 HHQQQQQQQQQQQQLQQQQGFQHDFR------------NSGNGNPNGNSNSGDHGERLNADSDSL 518
            ..::::..:..:::|     .:.|.|            .:|.......:.....|..|:...:.|
Human   237 EDEEEELLEDDEEEL-----LEDDARALLKEPRRCPVAATGAVAAAAAAAVATEGGELSPKEELL 296

  Fly   519 VNGSCASSEDLNQTNSSEQGEKITSGSDDEGQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHY 583
            ::...|..:|      .|....:::|||.|   :...|:|.||.|||||:|||.||||||:|:||
Human   297 LHPEDAEGKD------GEDSVCLSAGSDSE---EGLLKRKQRRYRTTFTSYQLEELERAFQKTHY 352

  Fly   584 PDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKSESLRLGLTHFTQLPHRLGCGASGLPVDP 648
            |||::||||||:::|.|.||||||||||||||::||:.:    .||           ..|||   
Human   353 PDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGA----QTH-----------PPGLP--- 399

  Fly   649 WLSPPLLSALPGFLS--HPQTVYPSYLTPPLSLAPGNLTMSSLAAMGHHHAHNGPPPPHVGHGGH 711
                     .||.||  ||       |:|.|..:|         ...||.|.:............
Human   400 ---------FPGPLSATHP-------LSPYLDASP---------FPPHHPALDSAWTAAAAAAAA 439

  Fly   712 GQPQPPPPP-----PPHGVP-------------HPHGSHHVVPLSHLSPHLSRMSPHATSLGSPH 758
            ..|..||||     ||.|.|             ||         :.:||...|            
Human   440 AFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHP---------AFISPAFGR------------ 483

  Fly   759 HGVTPLGTPLHSSLPPSSTATTVAVSSSQSSSSSASLECSGPDVCMSPQNLSIGNADSNGDGRDL 823
                     |.|::.|.::|:|.|....|                                    
Human   484 ---------LFSTMAPLTSASTAAALLRQ------------------------------------ 503

  Fly   824 SSDLDAGSTSSNPGSSLDKCAASANIELLDVGRDSPPPPPTPTGKGS---------STPPTDMRS 879
                                                   |||..:|:         :|...|.|:
Human   504 ---------------------------------------PTPAVEGAVASGALADPATAAADRRA 529

  Fly   880 NSIATLRIKAKEH---LDNLN 897
            :|||.||:|||||   |..||
Human   530 SSIAALRLKAKEHAAQLTQLN 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 41/52 (79%)
OAR 876..892 CDD:281777 11/16 (69%)
ARXNP_620689.1 GCG-encoded polyalanine repeat 102..111 3/9 (33%)
Homeobox 332..384 CDD:306543 41/52 (79%)
OAR 526..544 CDD:309087 12/18 (67%)
OAR. {ECO:0000255|PROSITE-ProRule:PRU00138} 530..543 10/13 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.