DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rx and rax

Sequence 1:NP_726006.3 Gene:Rx FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster
Sequence 2:XP_002936715.1 Gene:rax XenbaseID:XB-GENE-492665 Length:326 Species:Xenopus tropicalis

Alignment Length:362 Identity:135/363 (37%)
Similarity:174/363 (48%) Gaps:111/363 (31%)


  Fly   444 PGGNYG------------------------IRPRSMEEVHHQQQSH-HHQQQQQQQQQQQQLQQQ 483
            ||||..                        :.||:.:||..:...| .|:..::...||:.|:  
 Frog    24 PGGNPSRLHSIEAILGFSKEDSVLGSFQTEVSPRNAKEVDKRSSRHCLHKMTEEIHPQQEHLE-- 86

  Fly   484 QGFQHDFRNSGNGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSDDE 548
                 |.::.|.|:|.....|.:                |. |..|:.:|:|:  .|:   ||||
 Frog    87 -----DGQSDGYGDPYSGKTSSE----------------CL-SPGLSTSNNSD--NKL---SDDE 124

  Fly   549 GQDDNCAKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAK 613
            .|    .||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   125 QQ----PKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAK 185

  Fly   614 WRRQEKSE--SLRL---GLTHFTQLPHRLGCGA--SGLPVDPWLSPPL-----LSALPGFLSHPQ 666
            ||||||.|  |::|   .:..|.:.|......|  |.||:|.||:|.:     |.:||||::.|.
 Frog   186 WRRQEKLEVTSMKLQDSPILSFNRSPQPSAMSAISSSLPLDSWLTPSISNSTALQSLPGFVTSPP 250

  Fly   667 TVYPSYLTPPLSLAPGNL--TMSSLAAMGHHHAHNGPPPPHVGHGGHGQPQPPPPPPPHGVPHPH 729
            ::..|| |||..:.|.::  .:..|.|||                         ||||:..    
 Frog   251 SLPGSY-TPPPFINPASVGHALQPLGAMG-------------------------PPPPYQC---- 285

  Fly   730 GSHHV--VPLSHLSPHLS-------RMSPHATSLGSP 757
            |:..|  .||....|..:       :...|..|:|.|
 Frog   286 GASFVDKYPLEEADPRNNSIASLRMKAKEHIQSIGKP 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RxNP_726006.3 Homeobox 563..615 CDD:278475 52/52 (100%)
OAR 876..892 CDD:281777
raxXP_002936715.1 Homeobox 135..187 CDD:278475 52/52 (100%)
OAR 299..315 CDD:281777 1/16 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCKD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.