DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk1 and ippk-1

DIOPT Version :8

Sequence 1:NP_001097387.1 Gene:Ipk1 / 37360 FlyBaseID:FBgn0050295 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_496564.2 Gene:ippk-1 / 189456 WormBaseID:WBGene00012466 Length:454 Species:Caenorhabditis elegans

Alignment Length:383 Identity:83/384 (22%)
Similarity:119/384 (31%) Gaps:151/384 (39%)


  Fly    51 YRAEGNANLVLA----------LPQFKKVLRLPKM---ISSRLRQAAHQR--------------- 87
            :|.||.||.|::          :.:|.|..:...|   ..|.|..:..:|               
 Worm    21 FRGEGRANFVISARHRVSGVRIVWRFAKARKSGLMTVKARSELVNSYMERIVAPFFSDQYLVDMN 85

  Fly    88 ---------HELADEVARPEGQRVSSERAGTENAGDL-TMPDFMAYIGIMRRLLGNEF--VCGAD 140
                     |:||...:.|..|::       |...|| .:||..::..:      |.|  |.|:.
 Worm    86 IVEFDTVDVHQLAKIPSLPANQKI-------EKFEDLFELPDEYSFFPL------NTFQRVHGSV 137

  Fly   141 IVAIPKEDDRFWINEHIRAQRPVSRLDKEFVGPFGLLLPDVTQLPATFDVLLANLQAKGTTGDES 205
            ||..||                  ||.       .|.:.|.||||.|                  
 Worm   138 IVTNPK------------------RLT-------SLQMLDATQLPMT------------------ 159

  Fly   206 GAAAGVGDGGGVGRGAGTRTKNRSAVRRLGDTYAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKP 270
                 |.|.|.                  ..|..:|||||||:.|...:|               
 Worm   160 -----VMDSGH------------------SSTITVEIKPKQGFFQRHPNV--------------- 186

  Fly   271 KETTCNQEENEPSARDKCWCRFCSMQLLK-MHNGKIKRLGHYCPLDLFSGTPSRMLDALDALLAC 334
                           |...|..|.:|:.| ........:..:||||||||...||..|:.:|...
 Worm   187 ---------------DVPHCNNCILQIEKSCGQSHFSEMYDFCPLDLFSGNYCRMQKAIHSLFLV 236

  Fly   335 PQNNLRVFQNSNLIYGDHANSISFDELSSRVFPGEIMVLIKHLLVACLLREYEHPESK 392
            |..|||:|.:.|.::.|. ..:....:|..:||.........:...||.....|.:.|
 Worm   237 PHRNLRIFVDGNQVHSDE-KPLEEKMISEILFPRHDATSEDLISALCLALSGNHSKKK 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ipk1NP_001097387.1 Ins_P5_2-kin 51..>332 CDD:283696 69/322 (21%)
Ins_P5_2-kin <571..707 CDD:283696
ippk-1NP_496564.2 Ins_P5_2-kin 21..424 CDD:283696 83/384 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170731965
eggNOG 1 0.900 E1_KOG4749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195478at2759
OrthoFinder 1 1.000 FOG0006190
OrthoInspector 1 1.000 T474750
orthoMCL 1 0.900 OOG5_131096
Panther 1 1.100 LDO PTHR14456
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4454
TreeFam 1 0.960
1110.690

Return to query results.
Submit another query.