DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and 4CL1

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_175579.1 Gene:4CL1 AraportID:AT1G51680 Length:561 Species:Arabidopsis thaliana

Alignment Length:535 Identity:143/536 (27%)
Similarity:252/536 (47%) Gaps:63/536 (12%)


  Fly    39 YSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGT 103
            ::.|...:..|||...|.|.:...||::|..|.:|.:.:.|||.:...|........:||...|.
plant    51 FATKPCLINGPTGHVYTYSDVHVISRQIAANFHKLGVNQNDVVMLLLPNCPEFVLSFLAASFRGA 115

  Fly   104 PINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDL 168
            .....:|.|.....|...:.:..|:|..:......:..:::........|....::|        
plant   116 TATAANPFFTPAEIAKQAKASNTKLIITEARYVDKIKPLQNDDGVVIVCIDDNESVP-------- 172

  Fly   169 LADGCTGYDEKT--------LFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLNS------A 219
            :.:||..:.|.|        :.....:..||...:..|||.|||||||..:|:.|:.|      .
plant   173 IPEGCLRFTELTQSTTEASEVIDSVEISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDG 237

  Fly   220 KIPQL-FTSDTVLFCFSPLYWISCIFTLLASLVNGCR---RIITNRPFSVAYFADLVERHQVSFV 280
            :.|.| |.||.|:.|..|::.   |:.|.:.::.|.|   .|:....|.:....:|::|.:|:..
plant   238 ENPNLYFHSDDVILCVLPMFH---IYALNSIMLCGLRVGAAILIMPKFEINLLLELIQRCKVTVA 299

  Fly   281 LTVPHHMALLAKSPERQEL-AAKMQCVQSFVCSGSKVPMGIWRQLYELLGAN----RFAVLYGLT 340
            ..||..:..:|||.|.::. .:.::.|:|     ...|:|  ::|.:.:.|.    :....||:|
plant   300 PMVPPIVLAIAKSSETEKYDLSSIRVVKS-----GAAPLG--KELEDAVNAKFPNAKLGQGYGMT 357

  Fly   341 ETG-------GISKNVGGPL----GSEGRLLRNVQVRVVDPH-GQSLGPNQTGQILVRLNLRWGG 393
            |.|       |.:|.   |.    |:.|.::||.::::|||. |.||..||.|:|.:|.:....|
plant   358 EAGPVLAMSLGFAKE---PFPVKSGACGTVVRNAEMKIVDPDTGDSLSRNQPGEICIRGHQIMKG 419

  Fly   394 YYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGV 458
            |.:||..|..|:..|| ||.|||.|..||:..|....|..::.||..|.:.|.::|.:::..|.:
plant   420 YLNNPAATAETIDKDG-WLHTGDIGLIDDDDELFIVDRLKELIKYKGFQVAPAELEALLIGHPDI 483

  Fly   459 HEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIR-GGVFFVDNLPKT 522
            .:|||..:.:|.:..:....||:::|   ::|:|.|||..|::.:  .|:.| ..|||.:::||.
plant   484 TDVAVVAMKEEAAGEVPVAFVVKSKD---SELSEDDVKQFVSKQV--VFYKRINKVFFTESIPKA 543

  Fly   523 QNSKVQRRKIWSQLS 537
            .:.|:.|:.:.::|:
plant   544 PSGKILRKDLRAKLA 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 142/529 (27%)
AFD_class_I 45..528 CDD:302604 140/519 (27%)
4CL1NP_175579.1 PLN02246 16..560 CDD:215137 143/536 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.