DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and AT1G20500

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_173474.5 Gene:AT1G20500 AraportID:AT1G20500 Length:550 Species:Arabidopsis thaliana

Alignment Length:560 Identity:134/561 (24%)
Similarity:243/561 (43%) Gaps:83/561 (15%)


  Fly    24 PDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHA-FQRLKLQRGDVVGISAKN 87
            |:::......|..:.:..|...:...||:.||.|.|.....|:|.. :..:.::|||||.|.:.|
plant    34 PNLSRDVTTFISSQPHRGKTAFIDAATGQCLTFSDLWRAVDRVADCLYHEVGIRRGDVVLILSPN 98

  Fly    88 TTYLTEVVIAALLNG---TPINPLHPDFD-----AETTAYMFEITK---PK------VIFCDLDN 135
            :.::..|.::.:..|   |..|.|:...:     |::...:...|:   ||      |:..|.:.
plant    99 SIFIPVVCLSVMSLGAVFTTANTLNTSGEISKQIADSNPTLVFTTRQLAPKLPVAISVVLTDDEV 163

  Fly   136 YQTLSAVKSSLKFKTEIILLTGTL-------PGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTA 193
            ||.|          |..|.:.|.|       |..:.::|.:..                  ||||
plant   164 YQEL----------TSAIRVVGILSEMVKKEPSGQRVRDRVNQ------------------DDTA 200

  Fly   194 FIITSSGVTGLPKGVTRSHRSLLNSAKIPQLFTS----DTVLFCFSPLYWISCIFTLLASLVNGC 254
            .::.|||.||..|||..|||:|  :|.:.:..:.    |.:..|..|::....:.|.....|...
plant   201 MMLYSSGTTGPSKGVISSHRNL--TAHVARFISDNLKRDDIFICTVPMFHTYGLLTFAMGTVALG 263

  Fly   255 RRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMG 319
            ..::..|.|.:....|.||:|:.:.:...|..:..:....:..:....:..:::..|.|:.:...
plant   264 STVVILRRFQLHDMMDAVEKHRATALALAPPVLVAMINDADLIKAKYDLSSLKTVRCGGAPLSKE 328

  Fly   320 IWRQLYELLGANRFAVLYGLTETGGISKNVGGPL----------GSEGRLLRNVQVRVVDPH-GQ 373
            :.....|..........|.|||:.|     ||..          |:.|.|..:|:.|:|||: |:
plant   329 VTEGFLEKYPTVDILQGYALTESNG-----GGAFTNSAEESRRYGTAGTLTSDVEARIVDPNTGR 388

  Fly   374 SLGPNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKY 438
            .:|.||||::.::......||:.|.:.|..|:..:| ||.|||..|.|::|.|....|..::.||
plant   389 FMGINQTGELWLKGPSISKGYFKNQEATNETINLEG-WLKTGDLCYIDEDGFLFVVDRLKELIKY 452

  Fly   439 NHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHL 503
            ..:.:.|.::|.:::..|.:.:.||...||:.:.......|||..:   :.|:|..|...:::.:
plant   453 KGYQVPPAELEALLITHPDILDAAVIPFPDKEAGQYPMAYVVRKHE---SNLSEKQVIDFISKQV 514

  Fly   504 SDAFHIRGGVFFVDNLPKTQNSKVQRRKIWSQLSEATTHL 543
            :....|| .|.|::::|||.:.|..|:.:   :..||:.|
plant   515 APYKKIR-KVSFINSIPKTASGKTLRKDL---IKLATSKL 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 131/548 (24%)
AFD_class_I 45..528 CDD:302604 127/523 (24%)
AT1G20500NP_173474.5 PLN02574 16..542 CDD:215312 131/548 (24%)
4CL 32..542 CDD:213272 131/548 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.