DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and 4CL8

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_198628.2 Gene:4CL8 AraportID:AT5G38120 Length:550 Species:Arabidopsis thaliana

Alignment Length:528 Identity:129/529 (24%)
Similarity:237/529 (45%) Gaps:45/529 (9%)


  Fly    27 TLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHA-FQRLKLQRGDVVGISAKNTTY 90
            :|.....|..:.|..|...:...|...::.|.|.....|:|.. ...:.::|||||.:.:.||..
plant    38 SLDITTFISSQTYRGKTAFIDAATDHRISFSDLWMAVDRVADCLLHDVGIRRGDVVLVLSPNTIS 102

  Fly    91 LTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFC--DLDNYQTLSAVKSSLKFKTEII 153
            :..|.::.:..|..:...:|...|.........:.||:.|.  :|......|.:...|:...:.:
plant   103 IPIVCLSVMSLGAVLTTANPLNTASEILRQIADSNPKLAFTTPELAPKIASSGISIVLERVEDTL 167

  Fly   154 LLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAFIITSSGVTGLPKGVTRSHRSLLN- 217
            .:...|..|.|:.:::....:|...:.     .:..||||.::.|||.||..|||..||.:|:. 
plant   168 RVPRGLKVVGNLTEMMKKEPSGQAVRN-----QVHKDDTAMLLYSSGTTGRSKGVNSSHGNLIAH 227

  Fly   218 -SAKIPQLFTSDTVLF-CFSPLY-WISCIFTLLASLVNGCRRIITNRPFSVAYFADLVERHQVSF 279
             :..|.:.|......| |..||: ....:..:||:|..|...:|..| |.:......||:::.:.
plant   228 VARYIAEPFEQPQQTFICTVPLFHTFGLLNFVLATLALGTTVVILPR-FDLGEMMAAVEKYRATT 291

  Fly   280 VLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGS----KVPMGIWRQ-----LYELLGANRFAV 335
            ::.||..:..:....::......:..:::..|.|:    :|..|..::     :|:  |      
plant   292 LILVPPVLVTMINKADQIMKKYDVSFLRTVRCGGAPLSKEVTQGFMKKYPTVDVYQ--G------ 348

  Fly   336 LYGLTETGGISKNV-----GGPLGSEGRLLRNVQVRVVDPH-GQSLGPNQTGQILVRLNLRWGGY 394
             |.|||:.|...::     ....|:.|.|...|:.|:|||: ||.:|.||||::.::......||
plant   349 -YALTESNGAGASIESVEESRRYGAVGLLSCGVEARIVDPNTGQVMGLNQTGELWLKGPSIAKGY 412

  Fly   395 YHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVH 459
            :.|.:|   .:|.:| ||.|||..|.|::|.|....|..::.||..:.:.|.::|.::|:.|.:.
plant   413 FRNEEE---IITSEG-WLKTGDLCYIDNDGFLFIVDRLKELIKYKGYQVPPAELEALLLNHPDIL 473

  Fly   460 EVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQN 524
            :.||...||:.:.......|.|..:   :.|.|..|...:::.::....|| .|.|:|::|||.:
plant   474 DAAVIPFPDKEAGQFPMAYVARKPE---SNLCEKKVIDFISKQVAPYKKIR-KVAFIDSIPKTPS 534

  Fly   525 SKVQRRKI 532
            .|..|:.:
plant   535 GKTLRKDL 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 129/527 (24%)
AFD_class_I 45..528 CDD:302604 124/505 (25%)
4CL8NP_198628.2 PLN02574 17..542 CDD:215312 129/527 (24%)
4CL 33..542 CDD:213272 129/527 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.