DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and AT4G05160

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_192425.1 Gene:AT4G05160 AraportID:AT4G05160 Length:544 Species:Arabidopsis thaliana

Alignment Length:545 Identity:151/546 (28%)
Similarity:249/546 (46%) Gaps:50/546 (9%)


  Fly    16 PKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQRGDV 80
            |||     |:.:|..........|..|:......||:.||.|||.....||||.|.||.:::.||
plant    22 PKD-----PNTSLVSFLFRNSSSYPSKLAIADSDTGDSLTFSQLKSAVARLAHGFHRLGIRKNDV 81

  Fly    81 VGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSS 145
            |.|.|.|:.......:|....|......:|.:.....:...:.:.||:|   :...|....:|. 
plant    82 VLIFAPNSYQFPLCFLAVTAIGGVFTTANPLYTVNEVSKQIKDSNPKII---ISVNQLFDKIKG- 142

  Fly   146 LKFKTEIILL----TGTLPGVRNIQDLLADGCTGYDEK-TLFACPHLCGDDTAFIITSSGVTGLP 205
              |...::||    |..:|...|.:.|..|......|. :.:....:...|||.::.|||.||..
plant   143 --FDLPVVLLGSKDTVEIPPGSNSKILSFDNVMELSEPVSEYPFVEIKQSDTAALLYSSGTTGTS 205

  Fly   206 KGVTRSHRSLLNSAKIPQLFTSDT------VLFCFSPLYWISCIFTLLASLVNGCRRIITNRPFS 264
            |||..:|.:.: :|.:......|.      |..||.|::.:..:..:..|.:.....:::...|.
plant   206 KGVELTHGNFI-AASLMVTMDQDLMGEYHGVFLCFLPMFHVFGLAVITYSQLQRGNALVSMARFE 269

  Fly   265 VAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQ-SFVCSGSKVPMGIWRQLYELL 328
            :......:|:.:|:.:..||.....|:|    |.:..|..... .::.||: .|:|  :.|.|..
plant   270 LELVLKNIEKFRVTHLWVVPPVFLALSK----QSIVKKFDLSSLKYIGSGA-APLG--KDLMEEC 327

  Fly   329 GANRFAVL----YGLTETGGISKNVGGP------LGSEGRLLRNVQVRVVDPH-GQSLGPNQTGQ 382
            |.|...||    ||:|||.|| .:|..|      .||.|.|...|:.::|... |:|..|||.|:
plant   328 GRNIPNVLLMQGYGMTETCGI-VSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQPPNQQGE 391

  Fly   383 ILVRLNLRWGGYYHNPQETQVTVTPDGK-WLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPK 446
            |.||......||.:|||.|:.|:  |.| |:.|||.|||:::|.|:...|..::.||..|.:.|.
plant   392 IWVRGPNMMKGYLNNPQATKETI--DKKSWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPA 454

  Fly   447 QIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRG 511
            ::|.:::..|.:.:..|...|||.:..:....|||:.:   :.:||.|::..:|:.::....:| 
plant   455 ELEGLLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPN---SSITEQDIQKFIAKQVAPYKRLR- 515

  Fly   512 GVFFVDNLPKTQNSKVQRRKIWSQL 536
            .|.|:..:||:...|:.||::..|:
plant   516 RVSFISLVPKSAAGKILRRELVQQV 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 147/535 (27%)
AFD_class_I 45..528 CDD:302604 141/507 (28%)
AT4G05160NP_192425.1 PLN02246 11..544 CDD:215137 151/546 (28%)
4CL 21..536 CDD:213272 150/540 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.