DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and 4CL2

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_188761.1 Gene:4CL2 AraportID:AT3G21240 Length:556 Species:Arabidopsis thaliana

Alignment Length:543 Identity:147/544 (27%)
Similarity:260/544 (48%) Gaps:84/544 (15%)


  Fly    39 YSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGT 103
            ::.|...:..||||..|.:.:...||:||.....|.:::.|||.|...|:..:....:||...|.
plant    49 FAAKPCLINGPTGEVYTYADVHVTSRKLAAGLHNLGVKQHDVVMILLPNSPEVVLTFLAASFIGA 113

  Fly   104 PINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQ-- 166
            .....:|.|   |.|   ||:|              .|..|:.|.   |:..:..:..::|:|  
plant   114 ITTSANPFF---TPA---EISK--------------QAKASAAKL---IVTQSRYVDKIKNLQND 155

  Fly   167 ---------DLLADGCTGYDEKTLFACPH-------LCGDDTAFIITSSGVTGLPKGVTRSHRSL 215
                     |.:.:.|..:.|.|....|.       :..:|...:..|||.|||||||..:|:.|
plant   156 GVLIVTTDSDAIPENCLRFSELTQSEEPRVDSIPEKISPEDVVALPFSSGTTGLPKGVMLTHKGL 220

  Fly   216 LNS------AKIPQL-FTSDTVLFCFSPLYWISCIFT-LLASLVNGCRRIITNRPFSVAYFADLV 272
            :.|      .:.|.| |..|.|:.|..|::.|..:.: :|.||..|...:|..: |.:....:.:
plant   221 VTSVAQQVDGENPNLYFNRDDVILCVLPMFHIYALNSIMLCSLRVGATILIMPK-FEITLLLEQI 284

  Fly   273 ERHQVSFVLTVPHHMALLAKSPERQEL-AAKMQCVQSFVCSGSKVPMGIWRQLYELLGAN----R 332
            :|.:|:..:.||..:..:|||||.::. .:.::.|:|     ...|:|  ::|.:.:.|.    :
plant   285 QRCKVTVAMVVPPIVLAIAKSPETEKYDLSSVRMVKS-----GAAPLG--KELEDAISAKFPNAK 342

  Fly   333 FAVLYGLTETG-------GISKNVGGPL----GSEGRLLRNVQVRVVDPH-GQSLGPNQTGQILV 385
            ....||:||.|       |.:|.   |.    |:.|.::||.:::::||. |.||..|:.|:|.:
plant   343 LGQGYGMTEAGPVLAMSLGFAKE---PFPVKSGACGTVVRNAEMKILDPDTGDSLPRNKPGEICI 404

  Fly   386 RLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIED 450
            |.|....||.::|..|..|:..|| ||.|||.|:.||:..|....|..::.||..|.:.|.::|.
plant   405 RGNQIMKGYLNDPLATASTIDKDG-WLHTGDVGFIDDDDELFIVDRLKELIKYKGFQVAPAELES 468

  Fly   451 VILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIR-GGVF 514
            :::..|.:::|||..:.:|.:..:....|||::|   :.::|.::|..|::.:  .|:.| ..||
plant   469 LLIGHPEINDVAVVAMKEEDAGEVPVAFVVRSKD---SNISEDEIKQFVSKQV--VFYKRINKVF 528

  Fly   515 FVDNLPKTQNSKVQRRKIWSQLS 537
            |.|::||..:.|:.|:.:.::|:
plant   529 FTDSIPKAPSGKILRKDLRARLA 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 146/537 (27%)
AFD_class_I 45..528 CDD:302604 144/527 (27%)
4CL2NP_188761.1 PLN02246 14..553 CDD:215137 147/544 (27%)
4CL 32..546 CDD:213272 146/537 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.