DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and acsf3

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_021329817.1 Gene:acsf3 ZFINID:ZDB-GENE-121026-3 Length:579 Species:Danio rerio

Alignment Length:578 Identity:137/579 (24%)
Similarity:234/579 (40%) Gaps:128/579 (22%)


  Fly    30 EVALIILR--LYSDKVMQVYDPTGEELTGSQLLEQSRRLA-HAFQRLKLQRGDVVG-----ISAK 86
            :||.:..|  .|.||| .:.|.:|.. |...|.:.|:.|| |..:.|..|.||:.|     :.|.
Zfish    51 KVAPVFSRAPAYGDKV-AIMDHSGSH-TYHSLYKNSKILAGHITKALTCQSGDLQGKRISFLCAN 113

  Fly    87 NTTYLTEVVIAALLNG--TPINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSL--- 146
            :.:|......:.:..|  .|:...||..:.|   |:...::..::........||..:...|   
Zfish   114 DASYTVAQWASWMCGGIAVPLYRKHPLSELE---YVISDSQSSLLVAGQSFVDTLEPLAQKLGLP 175

  Fly   147 ---------KFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAFIITSSGVT 202
                     :|:.     |.|||     :|:::|                ..:..|.:|.:||.|
Zfish   176 CLKLPATSSQFED-----TQTLP-----EDMISD----------------WAERPAMLIYTSGTT 214

  Fly   203 GLPKGVTRSHRSLLNSAKIPQLFT-----SDTVLFCFSPLY-------------WI--SCIFTLL 247
            |.||||..:|.||  .|.:..|.:     .|.|:....||:             |:  :||....
Zfish   215 GRPKGVLHTHSSL--QAMVQGLVSEWAWHKDDVILHTLPLHHVHGIVNKLMCPLWVGATCIMLPD 277

  Fly   248 ASLVNGCRRIITNRPFSVAYF-------ADLVERHQVSFVLTVPHHMALLAKSPERQEL--AAKM 303
            .|......::|.::...|..|       :.|:|.:...|.            .|:.|:.  |...
Zfish   278 FSAQKVWEQLICSKSPMVNVFMAVPTIYSKLIEYYDQHFT------------QPQVQDFIRAVCK 330

  Fly   304 QCVQSFVCSGSKVPMGI---WRQLYELLGANRFAVLYGLTETG-GISKNVGGPL--GSEGRLLRN 362
            :.::..|...:.:|..:   |.::.:.:...|    ||:||.| .:|.:..||.  |:.|..|..
Zfish   331 ERIRLMVSGSAALPQPVLERWAEITDHVLLER----YGMTEIGMALSNSYKGPRVPGAVGVPLPG 391

  Fly   363 VQVR------VVDPHGQSLG-------PNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLT 414
            |:||      :|...|.|.|       ..:.|::|||.:..:..|::.||||:.:.|.| :|..|
Zfish   392 VEVRIMMNSSIVIAEGTSKGTQVKAGLEGKEGELLVRGSSVFQKYWNKPQETEESFTED-RWFKT 455

  Fly   415 GDHGYFDDEGCLHFQSR-DTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEV-STNLTAC 477
            ||...:.| |......| ..|:.|...:.|....:|..:|..|.:.:|||.|.||.. ...:||.
Zfish   456 GDTALYRD-GVYWIMGRTSVDIIKSGGYKISALDVERHLLAHPDITDVAVIGAPDATWGQKVTAV 519

  Fly   478 AVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPKTQNSKVQRRKIWSQ 535
            ..:|.    |..:..:|:|....:|:: ::.|..|:..|:::|:.|..||.::.:..|
Zfish   520 VQMRK----GKTMILSDLKAWAREHMA-SYSIPTGLILVEDMPRNQMGKVNKKDLLRQ 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 136/574 (24%)
AFD_class_I 45..528 CDD:302604 129/553 (23%)
acsf3XP_021329817.1 MCS 64..566 CDD:213307 132/558 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.