DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG11453

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_650832.1 Gene:CG11453 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster

Alignment Length:549 Identity:199/550 (36%)
Similarity:299/550 (54%) Gaps:41/550 (7%)


  Fly     2 ASTKYDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRL 66
            ::|::|.:.||||||:...::..|.::|::....:|.:.:.:.|:.|..|..||..:.:..:.|:
  Fly     4 STTQFDKYTKIWSGPRPASFFDADCSIGKILFAFMRNHPNSICQISDTEGTALTNGEAITFAIRI 68

  Fly    67 AHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFC 131
            |...:.:.|::.|||||...|||||..||:..||||||.:.:.|..|.:|..::|.||:||:|||
  Fly    69 AQQLKAMGLKQDDVVGIVGTNTTYLMPVVLGCLLNGTPFHAVSPWQDEDTIKHLFSITRPKLIFC 133

  Fly   132 DLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKT---LFACPH---LCGD 190
            |...:|.||.:...|  |:.:..|.....|:..::|||        |.|   |:..|.   |.||
  Fly   134 DGKCFQRLSIIARIL--KSHVYTLKDHRLGMPRVEDLL--------EPTTAELYYVPETLLLGGD 188

  Fly   191 DTAFIITSSGVTGLPKGVTRSHRSLLNSAKIPQLF-----TSDTVLFCFSPLYWISCIFTLLASL 250
            .|..|:.:||.|||||.|..|     |||   .||     |...||..||.:.|.:.:|.:|.|.
  Fly   189 HTVAILCTSGTTGLPKAVCIS-----NSA---CLFDFGFVTGQDVLLSFSTIDWSAGMFNMLFSC 245

  Fly   251 VNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSP--ERQELAAKMQCVQSFVCSG 313
            .:|..||||:||::..|...|||:::|:.:..||..:|.|.|:|  .:|.||:    ::.....|
  Fly   246 CHGSTRIITDRPYTPEYMIQLVEKYKVTLLTVVPQQVASLLKTPTLNKQRLAS----IRFVSVGG 306

  Fly   314 SKVPMGIWRQLYELLGANRFAVLYGLTETGGISKNVG-GPLGSEGRLLRNVQVRVVDPHGQSLGP 377
            ....:....:|.|.|...:.:..|.|||.||::.|:| ....|.||::..|:|:::|..|:|||.
  Fly   307 GSCYVANLLKLQEFLITGQISYGYALTECGGVAANMGVAKPSSVGRIVPGVRVKILDEAGRSLGH 371

  Fly   378 NQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFP 442
            .:||:|||.....|.|||.||.|::......| |..|||.||||:|..||...|..|:.:::...
  Fly   372 GETGEILVHNGKVWNGYYANPNESKRMQDYQG-WFHTGDMGYFDNENYLHIVERKEDLLRFHGAQ 435

  Fly   443 IYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHL-SDA 506
            ..|::||.||..||.|.|..|||:.:||..:..|.|||:..   |::|||.|:...||:.| .|.
  Fly   436 YSPQEIEQVIAELPDVIEACVFGLWNEVDGDPAAAAVVKIP---GSRLTEMDIVEYVAKRLVVDH 497

  Fly   507 FHIRGGVFFVDNLPKTQNSKVQRRKIWSQ 535
            ..:..||||:..||||.:.||.|::...|
  Fly   498 KQLHCGVFFLPELPKTGSGKVLRQQARDQ 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 190/526 (36%)
AFD_class_I 45..528 CDD:302604 186/498 (37%)
CG11453NP_650832.1 CaiC 18..530 CDD:223395 192/536 (36%)
Firefly_Luc_like 46..519 CDD:213279 186/499 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773425
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.