DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG11407

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_650831.1 Gene:CG11407 FlyBaseID:FBgn0038733 Length:538 Species:Drosophila melanogaster

Alignment Length:542 Identity:162/543 (30%)
Similarity:275/543 (51%) Gaps:45/543 (8%)


  Fly     6 YDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAF 70
            ||:..|||||.:.:.|:.|.:::||:....:|.:...:.|:.......||.::|...:..:|...
  Fly     9 YDADRKIWSGDQLEYYFDPHLSIGEIIFNEMRRHPQLIAQISATENTILTRAELQANAMHIASYM 73

  Fly    71 QRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDN 135
            :.|.|.:.|:|||.|:|||:::.|..|...||...:.|:..::..|...:|.||:|.:||||.|.
  Fly    74 RSLGLLQMDIVGIIARNTTHISAVAYACFFNGIAFHSLNISYEQSTIEKLFSITRPNIIFCDGDE 138

  Fly   136 YQTLSAVKSSLKFKTEIILL----TGTL--------PGVRNIQDL-LADGCTGYDEKTLFACPHL 187
            ::.:.:..:.|..|  ||.:    :|::        |..:|.|.: |..|               
  Fly   139 FEKVRSATAQLDVK--IITMRNHPSGSIRIDQVLSTPIEKNFQPVRLEQG--------------- 186

  Fly   188 CGDDTAFIITSSGVTGLPKGVT-RSHRSLLNSAKIPQLFTSDTVLFCFSPLYWISCIFTLLASLV 251
             .|.|..|:.|||.||:||.|| .:.|.:|||:   ...|::.|.:..|.|.||:.:.|.:.|.|
  Fly   187 -NDQTLAILCSSGTTGIPKAVTITNSRQILNSS---HSLTTNDVQYSHSTLDWITGLLTTVTSGV 247

  Fly   252 NGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKV 316
            ...:|||.:..|...:|..|||.||:::::..|.|||::..||  ....:.:..::.::..||:.
  Fly   248 FSTKRIIADNIFDPEFFMRLVEEHQITWIIQAPAHMAMMVNSP--SFTTSDLSSLRYYLFGGSRA 310

  Fly   317 PMGIWRQLYELLGANRFAVLYGLTETG---GISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLGPN 378
            .:....::...|..:.....||.||.|   .::.:......|.|||:..::::|:...|:||||:
  Fly   311 SVETQHRIRSRLSKDCLHFAYGFTELGSMAALNLHFDEKPNSVGRLVAGLKLKVICEKGESLGPD 375

  Fly   379 QTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPI 443
            :.|::.:.....|.|||.||:||. .:.....|..|||.||.||:|.::...|..|:.|:.:...
  Fly   376 EVGELCLWNGQYWAGYYGNPEETH-KMRDHHNWFHTGDLGYVDDDGFIYIVERKKDMLKFQNIMY 439

  Fly   444 YPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAF- 507
            ||.:||.||..:|.|.||.|||:.:|::.:....|||:..   |:.||..|:...|..|:...: 
  Fly   440 YPNEIESVISKMPDVVEVCVFGVWNEINGDEATAAVVKKR---GSALTAQDIVDYVETHIDAKYK 501

  Fly   508 HIRGGVFFVDNLPKTQNSKVQR 529
            .:.||...|::|.::.|.|..|
  Fly   502 QLNGGAIIVEDLVRSPNGKTNR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 155/528 (29%)
AFD_class_I 45..528 CDD:302604 149/501 (30%)
CG11407NP_650831.1 CaiC 26..523 CDD:223395 153/524 (29%)
Firefly_Luc_like 47..522 CDD:213279 149/502 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773535
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.