DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG6300

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster

Alignment Length:532 Identity:161/533 (30%)
Similarity:271/533 (51%) Gaps:25/533 (5%)


  Fly     6 YDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAF 70
            ||:.:|||||....:|:.||:::||:....:|.:.....|:....|..||..:||..:.|||...
  Fly     9 YDNDQKIWSGEPVVKYFDPDLSIGEIIFHEMRRHPQLTAQISATEGTVLTRGELLANAMRLASYM 73

  Fly    71 QRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDN 135
            :.|.|.:.|:|||..:|||::..|..|...||...:.|:..:|.:|...::::|:|.:||||.|.
  Fly    74 RSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCDGDE 138

  Fly   136 YQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAFIITSSG 200
            ::.:.:..:.|..|. :.:....|..:: |.:::|   |..:|....|......|.|..|:.|||
  Fly   139 FEKVRSATAELDVKI-VTMRNHPLDSIK-IDEVVA---TPIEENFQPAKLEKGNDQTLAILCSSG 198

  Fly   201 VTGLPKGVTRSHRSLLNSAKI----PQLFTSDTVLFCFSPLYWISCIFTLLASLVNGCRRIITNR 261
            .||.||.||     :.||..|    ..|.|:| |.:..:.|.||:.:.|.:.|.|....|||.:.
  Fly   199 TTGTPKAVT-----ITNSRHILAGNYHLTTAD-VQYSHNTLDWITGLLTTITSGVFSTTRIIADN 257

  Fly   262 PFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYE 326
            .|..|:...::|.::|::.:..|..|||:...|:.:  ...|..::.::..||:..:.:.:.:..
  Fly   258 AFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFE--TCDMSSLRCYMFGGSRAALEVQKGIRS 320

  Fly   327 LLGANRFAVLYGLTETGG---ISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRLN 388
            .|..:....:||.||.|.   |:.:.....||.|:|:..:::::::..|:||||::.|::.:..|
  Fly   321 RLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNGLKMKIINDDGESLGPDEIGEVCIMNN 385

  Fly   389 LRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVIL 453
            ..|.|||.|..||: .:.....|..:||.||.|.:|.|:...|..::.||.:...||..||.||.
  Fly   386 QHWSGYYGNEVETR-NMRDSLGWYHSGDLGYMDRDGFLYIMDRKKEMLKYQNIMYYPNDIESVIS 449

  Fly   454 HLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAF-HIRGGVFFVD 517
            .:|.|.||.||||...:..:..|.|||:   :||::|...||...|.......: .:.||...||
  Fly   450 EMPQVAEVCVFGIWSNIFGDEAAAAVVK---KLGSELEAQDVVDYVRSRTDSKYKQLNGGAVIVD 511

  Fly   518 NLPKTQNSKVQR 529
            :|.::.|.|..|
  Fly   512 DLQRSANGKTNR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 154/518 (30%)
AFD_class_I 45..528 CDD:302604 147/491 (30%)
CG6300NP_650828.1 CaiC 26..523 CDD:223395 152/514 (30%)
AFD_class_I 47..522 CDD:302604 147/492 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773846
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.