DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG4830

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_650160.1 Gene:CG4830 FlyBaseID:FBgn0037996 Length:534 Species:Drosophila melanogaster

Alignment Length:540 Identity:186/541 (34%)
Similarity:273/541 (50%) Gaps:41/541 (8%)


  Fly     6 YDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAF 70
            ||:..|||.|......:.|:.:||.:....:|.:...|.|:.|..|.|:|..|.|..:.|:|...
  Fly     8 YDAENKIWKGIPQNNPFKPETSLGRIIFKNMRNWPKNVCQISDSEGVEVTFGQALTWAIRIAQQL 72

  Fly    71 QRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDN 135
            :...|...|::||||:||||:....:|...:|||....:|..:..|..:::.|:|||:||.|.|:
  Fly    73 KSRGLDHKDIIGISARNTTYIMPTAVACFFHGTPFQSANPILEESTLKHLYNISKPKIIFTDADH 137

  Fly   136 YQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTG--YDEKTLFACPHLCGDDTAFIITS 198
            |..|.:..|:  ||.||||.|||..||.:||||||...|.  |....|...|    ..|..|:||
  Fly   138 YDKLYSATSA--FKPEIILTTGTKDGVLSIQDLLAPTKTEFFYQPTPLKEGP----SQTVAILTS 196

  Fly   199 SGVTGLPKGVTRSHRSLLNSAKIPQLFTSDTV-------LFCFSPLYWISCIFTLLASLVNGCRR 256
            ||.||:||.|..|:          .:.|.:||       :|..:.|.||:.::..:.|.||||.|
  Fly   197 SGTTGMPKAVCISN----------DILTQETVFVNGYDTIFISASLDWITGLWATIFSTVNGCTR 251

  Fly   257 IITNRPFSVAYFADLVERHQVSFVLTVPHHMALL----AKSPERQELAAKMQCVQSFVCSGSKVP 317
            ||:::||:..||..||.::.:::.|..|.|...|    ..:||:.....|:.      ..|.::.
  Fly   252 IISSKPFAADYFVYLVSKYSITYALIPPEHCCSLLDCPTATPEKLGSLTKLN------FGGGRMT 310

  Fly   318 MGIWRQLYELLGANRFAVLYGLTETGGISKNVGG-PLGSEGRLLRNVQVRVVDPHGQSLGPNQTG 381
            .....::.:|.........||:||.|.|..|.|. .|.:.|..|..:||::||..|..||.||||
  Fly   311 QATVERVKKLAPNGVLNSSYGMTEVGFIVFNHGHLKLTAAGNPLPGIQVKIVDDDGNQLGVNQTG 375

  Fly   382 QILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPK 446
            :|:|.....|.||:.:|:.|:.....:| |..|||.||||::..|:...|..:|.|:....::|.
  Fly   376 EIIVHNGFSWNGYFADPEATKAMQDEEG-WFHTGDMGYFDEDDYLYMTDRKKEVLKWKGLQMWPA 439

  Fly   447 QIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSD-AFHIR 510
            ::|.||..||.|..|.|.|:.||...::....|||.::   |.||...|...||:.|.| ...:|
  Fly   440 EVEAVIDELPEVKRVCVIGVYDETQGDVPGALVVREDN---ATLTAQQVIDHVAKRLPDIQKQLR 501

  Fly   511 GGVFFVDNLPKTQNSKVQRR 530
            .||.|.|.:|:..|.||.||
  Fly   502 AGVQFADEIPQNHNGKVVRR 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 180/526 (34%)
AFD_class_I 45..528 CDD:302604 173/498 (35%)
CG4830NP_650160.1 CaiC 18..529 CDD:223395 180/531 (34%)
AFD_class_I 46..518 CDD:302604 172/498 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773785
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.