DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG18586

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:557 Identity:164/558 (29%)
Similarity:265/558 (47%) Gaps:61/558 (11%)


  Fly     2 ASTKYDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKV------MQVYDPTGEELTGSQLL 60
            |...||...|||||.:....:.|::::||:      ::.|.|      .|:.......||...|.
  Fly    13 AMCTYDDKLKIWSGREAPSLFSPNLSIGEI------IFGDMVNNPKLIAQISITEDIVLTREDLH 71

  Fly    61 EQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITK 125
            ..:.|:|...:.:.|.:.|:||:..::||:.:.|..|...||||::.||..::....|.:|.|||
  Fly    72 MNAMRVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFGITK 136

  Fly   126 PKVIFCDLDNYQTLSAVKSSLK-FKTEIILLTG------------TLPGVRNIQDL-LADGCTGY 176
            |::||||.|.|:   .|||:.| .:..|:.:..            |.|.::|.|.| |.||.   
  Fly   137 PRLIFCDGDEYE---KVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGI--- 195

  Fly   177 DEKTLFACPHLCGDDTAFIITSSGVTGLPKGVT--RSHRSLLNSAKIPQLFTSDTVLFCFSPLYW 239
                         |.|..|::|||.:|.||.||  .||:.:::...|    .:..:.:..|.|.|
  Fly   196 -------------DHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAI----NNSNIQYTSSTLDW 243

  Fly   240 ISCIFTLLASLVNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQ 304
            .|.:...:.|.|.....||.:..|....|...:.::::|.||....::|:.|..||.:  :|.:.
  Fly   244 CSGLSMAITSGVFSTTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFE--SADLS 306

  Fly   305 CVQSFVCSGSKVPMGIWRQLYELLGANRFAVLYGLTE---TGGISKNVGGPLGSEGRLLRNVQVR 366
            .:...:..||...:.:.|::...|..:.....|||||   .|.::.|......|.||.:|.::::
  Fly   307 SLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIK 371

  Fly   367 VVDPHGQSLGPNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSR 431
            |:|..|::..||..|:|....:.:|.|||.||.||: .:.....|:.|||.||.|.:|.|....|
  Fly   372 VIDEQGEAQEPNVVGEICFHNSQKWAGYYKNPDETR-QIQDSENWIHTGDLGYVDKDGYLFVIDR 435

  Fly   432 DTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVK 496
            ..|:.||.:...||.:||:||..:|.|.|..||||.|.|:.:..|.::|:..   |.||...||.
  Fly   436 LKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKP---GTQLEAQDVV 497

  Fly   497 GVVAQHLSDAF-HIRGGVFFVDNLPKTQNSKVQRRKI 532
            ..|.:.::..| .:.||...||.:.::.|.|..|..:
  Fly   498 EYVRKRITAKFKQLNGGALIVDQIVRSGNRKTNRSAV 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 156/537 (29%)
AFD_class_I 45..528 CDD:302604 150/503 (30%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 156/536 (29%)
AFD_class_I 55..530 CDD:302604 150/504 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773735
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.