DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and CG8834

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_610779.1 Gene:CG8834 FlyBaseID:FBgn0033733 Length:535 Species:Drosophila melanogaster

Alignment Length:534 Identity:183/535 (34%)
Similarity:285/535 (53%) Gaps:19/535 (4%)


  Fly     1 MASTKYDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRR 65
            |..|.|:..:.||||.|....|..|.::|::....::.:...|.|:.|..|..:|..|.|..|.|
  Fly     3 MIPTTYNEKDNIWSGAKRNSIYNYDTSVGKIIFNNMKNWPKNVCQICDVDGVTVTFEQGLTWSIR 67

  Fly    66 LAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIF 130
            :|...::..|...||:||:|||:||:..:.:|.|:||||.:.::|..|..|..::|.||||.:||
  Fly    68 IAQYLKKRGLNHKDVIGIAAKNSTYVMPLGVACLMNGTPFHSVNPVLDDATLTHVFSITKPTLIF 132

  Fly   131 CDLDNYQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTG--YDEKTLFACPHLCGDDTA 193
            ||...|..:.  |:::.:..||:.||..:.||:.|:.||....|.  |..:.|    ...||.|.
  Fly   133 CDGQEYDKVH--KATVGWHPEILTLTDHVEGVQGIETLLDPTTTEKIYQPEVL----KEGGDQTV 191

  Fly   194 FIITSSGVTGLPKGVTRSHRSLLNSAKIPQLFTSDTVLFCFSPLYWISCIFTLLASLVNGCRRII 258
            .|:.|||.|||||.|..|:..|:..:   .|.||.:|::..|.|.||:.::..:.|.|.||.|||
  Fly   192 AILCSSGTTGLPKAVCISNSILIQDS---MLITSQSVIYVGSCLDWITGLWAFVFSTVFGCTRII 253

  Fly   259 TNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELAAKMQCVQSFVCSGSKVPMGIWRQ 323
            :|:.|:..||..||:::::::.:..|.|::.|...|:.:..|  :..:......|..:.:...::
  Fly   254 SNKAFTPEYFVGLVKKYKINYAVLPPRHLSALITCPDAKPDA--LAPITHLNYGGGSISLATLQR 316

  Fly   324 LYELLGANRFAVLYGLTETGGISKNVG-GPLGSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRL 387
            ..||.....|...||:||.|.|:.|:| ..:.|.||.:..:::|:||..|:|||.||.|:|.|..
  Fly   317 SQELCKTAMFNSGYGMTEVGAITINIGISNVSSAGRPVPGIKIRIVDEDGKSLGYNQVGEIYVHT 381

  Fly   388 NLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVI 452
            ...|.|||.||.||:.....:| |..|||.||||::..|:...|..::.|||....:|.:||.||
  Fly   382 GQAWNGYYGNPVETRRMQDFEG-WFHTGDLGYFDEQNFLYIVDRKKEILKYNGLHYWPTEIETVI 445

  Fly   453 LHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHL-SDAFHIRGGVFFV 516
            ..|..|.:|.|.||.||...:.....||:::   ||.::..::...||:.| :....:|.||.|.
  Fly   446 AELSQVQDVCVVGIYDEREGDAAGALVVKSK---GATISAKEIVEHVAKRLPATQKQLRAGVQFT 507

  Fly   517 DNLPKTQNSKVQRR 530
            |.||...|.|..|:
  Fly   508 DKLPANVNGKTMRK 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 175/515 (34%)
AFD_class_I 45..528 CDD:302604 170/487 (35%)
CG8834NP_610779.1 CaiC 20..529 CDD:223395 175/518 (34%)
AFD_class_I 46..519 CDD:302604 170/488 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773369
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.