DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and Acsf3

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_659181.2 Gene:Acsf3 MGIID:2182591 Length:583 Species:Mus musculus

Alignment Length:587 Identity:138/588 (23%)
Similarity:231/588 (39%) Gaps:132/588 (22%)


  Fly    27 TLGEVALIILRL-YSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLK------LQRGDVVGIS 84
            |.|.|.:.|..| :.|::..: |..|.. |..:|.::|..||....||:      ||...|..:.
Mouse    40 TDGSVPVFIRALAFGDRIALI-DKYGHH-TYRELYDRSLCLAQEICRLQGCKVGDLQEERVSFLC 102

  Fly    85 AKNTTYLTEVVIAALLNGTPINPL---HPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSL 146
            :.:.:|:. ...|:.::|....||   ||:...|   |..:.::..::....:..:.||.:...|
Mouse   103 SNDVSYVV-AQWASWMSGGVAVPLYWKHPEAQLE---YFIQDSRSSLVVVGQEYLERLSPLAQRL 163

  Fly   147 KFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCG--DDTAFIITSSGVTGLPKGVT 209
              ...::.||   |.|.:          |..||.........|  |..|.|..:||.||.|||..
Mouse   164 --GVPLLPLT---PAVYH----------GATEKPTEQPVEESGWRDRGAMIFYTSGTTGRPKGAL 213

  Fly   210 RSHRSLLNSAKIPQL-----FTSDTVLFCFSPLY-------------WI--SCIFTLLASLVNGC 254
            .:||:|  :|.:..|     :|.:.|:....||:             |:  :|:.....|.....
Mouse   214 STHRNL--AAVVTGLVHSWAWTKNDVILHVLPLHHVHGVVNKLLCPLWVGATCVMLPEFSAQQVW 276

  Fly   255 RRIITNRPFSVAYF----------ADLVERHQVSFVLTVPHHMALL-AKSPERQELAAKMQCVQS 308
            .:.:::....:..|          .|..::|     .|.||....: |...||         ::.
Mouse   277 EKFLSSEAPQITVFMAVPTVYSKLLDYYDKH-----FTQPHVQDFVRAVCKER---------IRL 327

  Fly   309 FVCSGSKVPMGI---WRQLYELLGANRFAVL--YGLTETGGISKNVGGPL------GSEGRLLRN 362
            .|...:.:|:.:   ||      .|....:|  ||:||.|....|   ||      ||.|..|..
Mouse   328 MVSGSAALPVPLLEKWR------SATGHTLLERYGMTEIGMALSN---PLTEARVPGSVGTPLPG 383

  Fly   363 VQVRVVDPHGQSLGP-------------------NQTGQILVRLNLRWGGYYHNPQETQVTVTPD 408
            |:||::..:.|...|                   .:.|::|||....:..|:..|:||:...|.|
Mouse   384 VEVRIISENPQKGSPYIIHAEGNERGTKVTPGFEEKEGELLVRGPSVFREYWDKPEETKSAFTSD 448

  Fly   409 GKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTN 473
            | |..|||...|.|...........|:.|...:.:...:||..:|..|.:.:|||.|:|| ::..
Mouse   449 G-WFRTGDTAVFKDARYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPD-MTWG 511

  Fly   474 LTACAVVRNEDELGAQLTEADVK----GVVAQHLSDAFHIRGGVFFVDNLPKTQNSKVQRRKIWS 534
            ....|||..::  |..|:..|:|    ||:|     .:.:...:..|:.:|:.|..||.::::..
Mouse   512 QRVTAVVALQE--GHSLSHGDLKEWARGVLA-----PYAVPSELLLVEEIPRNQMGKVNKKELLK 569

  Fly   535 QL 536
            ||
Mouse   570 QL 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 136/582 (23%)
AFD_class_I 45..528 CDD:302604 130/559 (23%)
Acsf3NP_659181.2 CaiC 49..572 CDD:223395 134/579 (23%)
MCS 55..564 CDD:213307 131/564 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.