DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and C25G6.3

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_508231.2 Gene:C25G6.3 WormBaseID:WBGene00016108 Length:578 Species:Caenorhabditis elegans

Alignment Length:519 Identity:110/520 (21%)
Similarity:198/520 (38%) Gaps:110/520 (21%)


  Fly    22 YGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAFQRLKLQRGDVVGISAK 86
            |.|    .::|||      :::.:|...|.||     |::.|:|.|:......::.||.:.:..:
 Worm    98 YNP----AKIALI------EEISEVRCVTYEE-----LVDGSKRTANYMSHHGVKNGDRILMCME 147

  Fly    87 NTT-YLTEVVIAALLNGTP--INPLHPDFDAETTAYMFEITKPKV--IFC-----DLDNY-QTLS 140
            ||. |:...:...||...|  |||.|             |...|:  |.|     |.::| ..|.
 Worm   148 NTVEYVLYQLGGFLLGAIPVLINPSH-------------IASEKLSDIGCTTAIVDFEHYGHMLR 199

  Fly   141 AVKSSLKFKTEIILLTGTLPGV---RNIQDLLADGCTGYDEKTLFACPHL---CGDDTAFIITSS 199
            ..:|:|:....:.:|...:..:   |::..:.|.|..|:...  :.|...   ..|..||||..|
 Worm   200 ISQSTLQSIERVFVLAEDIAAISLARHVWVIDAFGFLGFPPN--YVCDQFIEESNDSVAFIIPGS 262

  Fly   200 GVTGLPKGVTRSHR----------------SLLNSAKIPQLFTSDTV----LFCFSPLYWISCIF 244
                |......||.                .:|.  |..||.:.:.:    |.|...|.::..|.
 Worm   263 ----LENDQYISHSQESGFHLCHDYFEQLFGMLK--KTEQLGSKNHLITDGLHCHDALSYLYTIL 321

  Fly   245 T------LLASLVNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQ------ 297
            |      |..|.::..|..:.:|      .|.::|:::|:.:.:....:....|....:      
 Worm   322 TKGESCILAESTMDVWRASLLDR------IAGIIEQYKVTLLFSNSQLLKCFIKYEVHKIYNLSS 380

  Fly   298 -ELAAKMQCVQSFVCSGSKVPMGIWRQLYELLGANRFAVLYGLTETGGISKNVGGPLGSEGRLLR 361
             |:.|....|.| |.:..||...:...|.:...|..|    |:...|...:.:...|.:.|..:.
 Worm   381 LEIVANHGAVVS-VATAKKVKKILDVTLIQAYSAAEF----GVASFGDFDETLDKQLVNCGHSID 440

  Fly   362 NVQVRVVDPH---GQSLGPNQTGQILVRLNLRWGGYYHNPQETQVTVTPDGK-WLLTGDHGYFDD 422
            :|:::|: .|   .:.:...:.||:::........|..|.:..  |....|| |..|||:|..|:
 Worm   441 DVKIKVI-AHMETDKEMAKGKWGQVILSGRQLLKEYIGNKELN--TSRKFGKSWFKTGDYGMIDE 502

  Fly   423 EGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAV-VRNEDE 485
            ...:|.:...:|:....:..:..:.:|.:|.....||:|.|......|     .|.| ::||:|
 Worm   503 NDRVHIEGAISDLITAQNKLVSSEMMESIICEHKMVHDVVVMQNDQHV-----WCGVLLKNENE 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 110/520 (21%)
AFD_class_I 45..528 CDD:302604 105/497 (21%)
C25G6.3NP_508231.2 AMP-binding 99..516 CDD:278902 97/467 (21%)
AFD_class_I 115..543 CDD:302604 97/468 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92390121
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.