DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and C32E8.6

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_740831.1 Gene:C32E8.6 WormBaseID:WBGene00016324 Length:461 Species:Caenorhabditis elegans

Alignment Length:487 Identity:103/488 (21%)
Similarity:194/488 (40%) Gaps:119/488 (24%)


  Fly    81 VGISAKNTTYLTEVVIAALLNGTPINPLHPDFDA-ETTAYM------FEITKPKVIFCDLDNYQT 138
            :.:...|:..:..:::|..|:|..:.||:|.:.. |...|:      |.|....|   |||.:: 
 Worm    58 IALFCTNSPDILAIIVAGQLSGVTVIPLNPSYKKYEIDEYISKSIANFIIVSDDV---DLDKFE- 118

  Fly   139 LSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAFIITSSGVTG 203
                      :.|:.|          |.:|.....|   ..:..:.|...|   ..:..|||.||
 Worm   119 ----------EREVNL----------ISELFTSNVT---PSSTASTPENQG---VIVFFSSGTTG 157

  Fly   204 LPKGVTRSHR---SLLNSAKI----PQLFTSDTVLFCFS--PLYWISCIFTLLASLVNGCRRIIT 259
            .||....:.|   |.::..|.    |:.|:..|...|:.  |.:....:.|:|:.:.:||..:|.
 Worm   158 PPKQFEYTQRILCSQIDQIKAIRSDPRFFSPSTDDICYGVLPFFHAGGLITILSMIFSGCTVLIN 222

  Fly   260 NRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSP--ERQELAAKMQCVQSFVCSGSKVPMGIWR 322
            .|.....:.|: .:.::||.:..||..:...|..|  ...:|:| ::.:  :|.:.:..|....:
 Worm   223 ERWNEHEFLAN-CQNYKVSVLFLVPPVLNFFANHPLVSSYDLSA-LKTI--YVGAAASPPENFAK 283

  Fly   323 QLYELLGANRFAVLYGLTETGGISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLG---PNQTGQIL 384
            ....|........|||.:|.|.:..:.|....|                |:::|   |      .
 Worm   284 VAERLPELENLIQLYGTSECGVLLCSTGKGKAS----------------GKTVGWPFP------F 326

  Fly   385 VRLNLRWGGYYHNPQETQVTVTPDGKWLLTGDHGYFD--DEGCLHFQS-------RDTDVFKYNH 440
            |.|.:       ||:..::.|    |.....:.|:.:  |.|||.|::       |..::.|...
 Worm   327 VELKI-------NPENNEIFV----KSATAMEEGFMETGDLGCLSFKTIELMIVGRSKEMMKIRG 380

  Fly   441 FPIYPKQIEDVILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQL-----TEADVKGVVA 500
            :.:.|.::||||..:.||.:                |||.:|:::|.|::     ::||:..:|.
 Worm   381 WQVNPNEVEDVIRKVEGVLD----------------CAVYQNQEKLTAKIIGNPDSKADIFKIVK 429

  Fly   501 QHLSDAFHIRGGVFFVDNLPKTQNSKVQRRKI 532
            .:|: ::.....|.||:.||:..:.|:.|..:
 Worm   430 DNLA-SYKQLDDVIFVEELPRNPSGKLVRHML 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 103/486 (21%)
AFD_class_I 45..528 CDD:302604 102/482 (21%)
C32E8.6NP_740831.1 CaiC 8..457 CDD:223395 102/483 (21%)
AFD_class_I 57..455 CDD:302604 102/481 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.