DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9993 and acsf3

Sequence 1:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001121382.2 Gene:acsf3 XenbaseID:XB-GENE-964811 Length:589 Species:Xenopus tropicalis

Alignment Length:401 Identity:98/402 (24%)
Similarity:163/402 (41%) Gaps:84/402 (21%)


  Fly   190 DDTAFIITSSGVTGLPKGVTRSHRSLLN--SAKIPQL-FTSDTVLFCFSPLY------------- 238
            |..|.||.:||.||.||||..:|.:|.:  ||.:.:. :|.:..:....||:             
 Frog   208 DRGAMIIYTSGTTGRPKGVLSTHYNLYSMVSALVTEWGWTKEDSILHVLPLHHVHGVVNKLMCPL 272

  Fly   239 WISCIFTLL----------------ASLVNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHM 287
            |:.....:|                |..:|....:.|.....::|:    |:|            
 Frog   273 WVGATCVMLPDFCPQKVWQHFLRRDAPSINIFMAVPTIYSKLISYY----EQH------------ 321

  Fly   288 ALLAKSPERQEL-AAKMQCVQSFVCSGSKVPMGIWRQLYELLGANRFAVLYGLTETG-GISKNVG 350
              ...|..|:.: ||..:.::..|...|.:|:.|..:..|:.| :.....||:||.| .::..:.
 Frog   322 --FTHSNVREFVRAACQERIRLMVSGSSALPVPILERWQEITG-HTLLERYGMTEIGMALTNPLH 383

  Fly   351 GPL--GSEGRLLRNVQVRVV--DP-----------HGQSLG-------PNQTGQILVRLNLRWGG 393
            ||.  |:.|..|..|:||.|  :|           ||.|.|       .|:.|::.|:....:..
 Frog   384 GPRVPGAVGNPLPGVEVRTVTQNPRKEGTSYTVHAHGDSTGTMVSVGLENREGELQVQGPAVFKE 448

  Fly   394 YYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLPGV 458
            |::.|.|||...|.|| |..|||...:.|...........|:.|...:.:...::|..:|..|.:
 Frog   449 YWNKPHETQEAFTSDG-WFKTGDTAVYKDGTYWILGRTSVDIIKSGGYKVSALEVERHLLGHPSI 512

  Fly   459 HEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEAD--VKGVVAQHLSDAFHIRGGVFFVDNLPK 521
            .:|||.|.|| |:......|:|:..|.....|.|..  .:.|:|.:...|..||     |:.:|:
 Frog   513 TDVAVIGAPD-VTWGQRVAAIVKLRDGHALSLQELKEWARAVMAPYCIPAELIR-----VEEIPR 571

  Fly   522 TQNSKVQRRKI 532
            .|..|:.::::
 Frog   572 NQMGKINKKQL 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9993NP_611518.1 CaiC 21..532 CDD:223395 98/400 (25%)
AFD_class_I 45..528 CDD:302604 98/396 (25%)
acsf3NP_001121382.2 CaiC 61..582 CDD:223395 98/400 (25%)
MCS 67..579 CDD:213307 98/397 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.