DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and 4CL1

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_175579.1 Gene:4CL1 AraportID:AT1G51680 Length:561 Species:Arabidopsis thaliana

Alignment Length:541 Identity:149/542 (27%)
Similarity:250/542 (46%) Gaps:50/542 (9%)


  Fly    21 DFYGP-EMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRLGLRRGDVVGI 84
            |.|.| .::|.:.|.:.:...|.:...|...||...|.:.:...|.:||..|.:||:.:.|||.:
plant    31 DIYIPNHLSLHDYIFQNISEFATKPCLINGPTGHVYTYSDVHVISRQIAANFHKLGVNQNDVVML 95

  Fly    85 SANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQN 149
            ...|........:||..||......:|.||...:......:..|:|..:......||    .|||
plant    96 LLPNCPEFVLSFLAASFRGATATAANPFFTPAEIAKQAKASNTKLIITEARYVDKIK----PLQN 156

  Fly   150 PAKIYLV----NGKL---EGVLDISEMLNDEDSITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKG 207
            ...:.:|    |..:   ||.|..:|:  .:.:..|:..:...::..|....:..||||||:|||
plant   157 DDGVVIVCIDDNESVPIPEGCLRFTEL--TQSTTEASEVIDSVEISPDDVVALPYSSGTTGLPKG 219

  Fly   208 VTRSHRSLLCNC------KNPNTYTR-DSVLLSFSPLYWISG-TIILLASLLNGCRRIITNRPYS 264
            |..:|:.|:.:.      :|||.|.. |.|:|...|::.|.. ..|:|..|..|...:|..: :.
plant   220 VMLTHKGLVTSVAQQVDGENPNLYFHSDDVILCVLPMFHIYALNSIMLCGLRVGAAILIMPK-FE 283

  Fly   265 VEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCRRMYELI 329
            :..||:|:.|.|||...:....:..::|  |...| |..|.||||:....:.:.|.:...:....
plant   284 INLLLELIQRCKVTVAPMVPPIVLAIAK--SSETE-KYDLSSIRVVKSGAAPLGKELEDAVNAKF 345

  Fly   330 GNQRFVVGYGLSEMGG-LSKNVG-----GPV--GCEGKVMRNVELRVLDKLKMP-----LGINEV 381
            .|.:...|||::|.|. |:.::|     .||  |..|.|:||.|::::|    |     |..|:.
plant   346 PNAKLGQGYGMTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKIVD----PDTGDSLSRNQP 406

  Fly   382 GIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYP 446
            |.|..|......||..||.||...:..|| |..|||||.:|.:..|:|..|..::.|:..||:.|
plant   407 GEICIRGHQIMKGYLNNPAATAETIDKDG-WLHTGDIGLIDDDDELFIVDRLKELIKYKGFQVAP 470

  Fly   447 EQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAYHIR 511
            .::|..::..|.:::..|..:.:..:..:....||::|..|   |:.|.::..|...:  .::.|
plant   471 AELEALLIGHPDITDVAVVAMKEEAAGEVPVAFVVKSKDSE---LSEDDVKQFVSKQV--VFYKR 530

  Fly   512 -GGVYFIDSLPKTPNDKLQRR 531
             ..|:|.:|:||.|:.|:.|:
plant   531 INKVFFTESIPKAPSGKILRK 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 147/538 (27%)
AFD_class_I 38..529 CDD:302604 143/520 (28%)
4CL1NP_175579.1 PLN02246 16..560 CDD:215137 149/542 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.